LexiTopic: Energy & Lighting
The LexiConnexxions analysis has identified 95 words that are used in 103 different ways related to Engineering in the A-O portion of Spelling Bee lexicon, which comprises 74% of the entire lexicon.
The list is given below, followed by the topical analysis, with definitions.
Words marked with an asterisk have been used in at least one Spelling Bee puzzle, then subsequently disallowed; they are retained here for historical interest.
Words marked with an asterisk have been used in at least one Spelling Bee puzzle, then subsequently disallowed; they are retained here for historical interest.
Words Related to ENERGY AND LIGHTING in the Spelling Bee lexicon: Word List
ABLAZEAFLAMEBACKLOGBANKBILLETBLAZEBOLTBRANDBULBBURNBURNINGBURNTBUTTBUTTEDBUTTING
CANDELACANDLE
CANTCATCH
CHARCHARRINGCHIMNEYCHIPCHIPPEDCHIPPINGCLAVECLEAVECLEFTCOALCOKE
COKED*CONVECTCONVECTIONCONVECTIVE
CORDCORKBOARDDEADDEADWOODDEALDIFFRACTDUFFETHANEETHANOLFLAMEFLINT
FLOODFLOODEDFLOODINGFLOWFLUE
FRACKFUELFUELEDFUELINGFUMEDHEADLAMPIGNITEIGNITINGIGNITIONINCIDENCE
INFLAMEKNOTKNOTHOLE
LAMPLEANLEANLYLIGHTLIGHTBULBLIGHTEDLIGHTINGLIMBLIMELIGHTLINKLIVELOAD
LOGGEDLOGGINGLOGROLLLUMEN
MADEMAKEMAKINGMANTLEMATCHMETHANENAKEDNEONNIGHTLIGHTNONCONDUCTORNUKE
OILEDOILINGOILYOPTICALOUTPUT
Words Related to ENERGY AND LIGHTING in the Spelling Bee lexicon: Topical Arrangement
Subject Headings
Energy Transfer and ConductivityFuels other than woodFireLighting, Lamps, and Illumination not sensationsWood, Lumber, and Lumbering wood as fuel
Words about Energy
Energy Transfer and Conductivity
CONVECT: to transfer heat by convectionCONVECTION: the transfer of heat by convectionCONVECTIVE: characterized by the transfer of heat by convectionCORKBOARD: a heat-insulating material made of compressed granulated cork; or a bulletin board made with this materialFLOW: a continuous transfer of energyNONCONDUCTOR: a substance that conducts heat, electricity, or sound only in very small degree
Fire
ABLAZE: being on fireAFLAME: afireBACKLOG: a large log at the back of a hearth fireBANK: to restrict the flow of air to (a fire) especially by piling ash around or over the burning embersBLAZE: an intensely burning fire; an active burning, especially: a sudden bursting forth of flame; also, to burn brightly (the sun blazed overhead); to flare up: to flameBURN: to consume fuel and give off heat, light, and gases; to undergo combustion; to undergo alteration or destruction by the action of fire or heat (the house burned down); to cause (something) to undergo combustion, especially: to destroy (something) by fire (they burned all his letters.); to transform (something) by exposure to heat or fire (burn wood into charcoal); to produce (something) by burning (burned a hole in his sleeve); to contain a fire (a little stove burning in the corner); to injure or damage (something or someone) by or as if by exposure to fire, heat, or radiation: to scorch (burned her hand); also, the injury or damage resulting from exposure to fire, heat, caustics, electricity, or certain radiations; also, a burned area (a burn on the tabletop); an act, process, instance, or result of burningBURNING: to consume fuel and give off heat, light, and gases; to undergo combustion; to undergo alteration or destruction by the action of fire or heat (the house burned down); to cause (something) to undergo combustion, especially: to destroy (something) by fire (they burned all his letters.); to transform (something) by exposure to heat or fire (burn wood into charcoal); to produce (something) by burning (burned a hole in his sleeve); to contain a fire (a little stove burning in the corner); to injure or damage (something or someone) by or as if by exposure to fire, heat, or radiation: to scorch (burned her hand); also, the injury or damage resulting from exposure to fire, heat, caustics, electricity, or certain radiations; also, a burned area (a burn on the tabletop); an act, process, instance, or result of burningBURNT: to consume fuel and give off heat, light, and gases; to undergo combustion; to undergo alteration or destruction by the action of fire or heat (the house burned down); to cause (something) to undergo combustion, especially: to destroy (something) by fire (they burned all his letters.); to transform (something) by exposure to heat or fire (burn wood into charcoal); to produce (something) by burning (burned a hole in his sleeve); to contain a fire (a little stove burning in the corner); to injure or damage (something or someone) by or as if by exposure to fire, heat, or radiation: to scorch (burned her hand); also, the injury or damage resulting from exposure to fire, heat, caustics, electricity, or certain radiations; also, a burned area (a burn on the tabletop); an act, process, instance, or result of burningCATCH: to catch fireCHAR: to burn, or to convert to charcoal or carbon usually by heat; shortened from charcoalCHARRING: to burn, or to convert to charcoal or carbon usually by heat; shortened from charcoalCHIMNEY: a vertical structure incorporated into a building and enclosing a flue or flues that carry off smoke, especially: the part of such a structure extending above a roof; a smokestackDEAD: grown cold: extinguished (The fire was dead; dead coals)FLAME: the glowing gaseous part of a fire, or a state of blazing combustionFLINT: a material used for producing a spark, especially: an alloy (as of iron and cerium) used in lightersFLUE: a channel in a chimney for conveying flame and smoke to the outer air, or a pipe for conveying flame and hot gases around or through water in a steam boilerFUMED: to give off in fumes (fuming thick black smoke); to expose to or treat with fumes; to emit fumes; to rise in or as if in fumesIGNITE: to set afire; kindle; to cause (a fuel) to burnIGNITING: to set afire; kindle; to cause (a fuel) to burnIGNITION: to set afire; kindle; to cause (a fuel) to burn; the process or means (such as an electric spark) of igniting a fuel mixture; the act or action of igniting: such as the starting of a fireINFLAME: to set on fire: kindle; to burst into flameLIGHT: to take fire; to set fire to; to ignite something; also, a flame for lighting something (such as a cigarette) (give me a light); also, a candleLIGHTED: to take fire; to set fire to; to ignite somethingLIGHTING: ignitionLIGHTING: to take fire; to set fire to; to ignite somethingLINK: a torch formerly used to light a person's way through the streetsLIVE: afire, glowing (live coals)MADE: to assemble and set alight the materials for (a fire)MAKE: to assemble and set alight the materials for (a fire)MAKING: to assemble and set alight the materials for (a fire)MATCH: a short slender piece of flammable material (such as wood) tipped with a combustible mixture that bursts into flame when slightly heated through friction (as by being scratched against a rough surface)
Fuels (other than wood)
BURN: to use (something) as fuel (this furnace burns gas.)BURNING: to use (something) as fuel (this furnace burns gas.)BURNT: to use (something) as fuel (this furnace burns gas.)COAL: a glowing ember, or charcoal, or a black or brownish-black solid combustible substance … widely used as a natural fuelCOKE: the residue of coal left after destructive distillation and used as fuelCOKED*: converted to coke (from coal dust)DUFF: fine coal; slack, that is, the finest screenings of coal produced at a mine unusable as fuel unless cleanedETHANE: a colorless odorless gaseous alkane C2H6 found in natural gas and used as a fuelETHANOL: a colorless volatile flammable liquid C2H5OH that is the intoxicating agent in liquors and is also used as a solvent and in fuelFRACK: the injection of fluid into shale beds at high pressure in order to free up petroleum resources (such as oil or natural gas). Short for (hydraulic) fracturingFUEL: a material used to produce heat or power by burningFUELED: to provide with fuelFUELING: to provide with fuelLEAN: low in combustible component —used especially of fuel mixturesLEANLY: low in combustible component —used especially of fuel mixturesMETHANE: a colorless odorless flammable gaseous hydrocarbon CH4 that is a product of biological decomposition of organic matter and of the carbonization of coal, is used as a fuel and as a starting material in chemical synthesis, and is the simplest of the alkanesNUKE: a nuclear-powered electric generating station
OILED: to take on fuel oilOILING: to take on fuel oilOILY: of, relating to, or consisting of oil
Lighting, Lamps, and Illumination
BULB: a glass envelope enclosing the light source of an electric lamp or such an envelope together with the light source it enclosesCANDELA: the base unit of luminous intensity in the International System of UnitsCANDLE: a usually molded or dipped mass of wax or tallow containing a wick that may be burned (as to give light, heat, or scent or for celebration or votive purposes); also, something resembling a candle in shape or use (a sulfur candle for fumigating); also, a candela, the base unit of luminous intensity in the International System of UnitsCHIMNEY: a tube usually of glass placed around a flame (as of a lamp)DIFFRACT: to cause diffraction, “a modification which light undergoes especially in passing by the edges of opaque bodies or through narrow openings and in which the rays appear to be deflected”FLOOD: a floodlight, an artificial illumination in a broad beam; also, a source of such illumination; also, a lighting unit for projecting a broad beam of lightfloodlight; also, to illuminate by means of one or more floodlightsFLOODED: a floodlight, an artificial illumination in a broad beam; also, a source of such illumination; also, a lighting unit for projecting a broad beam of lightfloodlight; also, to illuminate by means of one or more floodlightsFLOODING: a floodlight, an artificial illumination in a broad beam; also, a source of such illumination; also, a lighting unit for projecting a broad beam of lightfloodlight; also, to illuminate by means of one or more floodlightsHEADLAMP: the beam of light cast by a headlightINCIDENCE: the angle of incidence: the angle that a line (such as a ray of light) falling on a surface or interface makes with the normal drawn at the point of incidence; also, the arrival of something (such as a projectile or a ray of light) at a surfaceLAMP: any of various devices for producing light or sometimes heat: such as a vessel with a wick for burning an inflammable liquid (such as oil) to produce light; or a glass bulb or tube that emits light produced by electricity (such as an incandescent light bulb or fluorescent lamp);LIGHT: an electric lightLIGHTBULB: an electric lamp: such as one in which a filament gives off light when heated to incandescence by an electric current; also, one having a coating of fluorescent material on its inner surface that emits visible light: a fluorescent lamp, especially a compact fluorescent light; also, one using LEDs to generate lightLIMELIGHT: a stage lighting instrument producing illumination by means of an oxyhydrogen flame directed on a cylinder of lime and usually equipped with a lens to concentrate the light in a beam; also, the white light produced by such an instrumentLINK: a torch formerly used to light a person's way through the streetsLUMEN: a unit of luminous flux equal to the light emitted in a unit solid angle by a uniform point source of one candle intensityMANTLE: a lacy hood or sheath of some refractory material that gives light by incandescence when placed over a flameNAKED: not provided with a shade (a naked light bulb)NEON: a discharge lamp in which the gas contains a large proportion of neon; also, the illumination provided by such lampsNIGHTLIGHT: M-W has night-light, a light kept burning throughout the night
OPTICAL: using the properties of light to aid vision (an optical instrument); also, of, relating to, or utilizing light especially instead of other forms of energy (optical microscopy)OUTPUT: power or energy produced or delivered by a machine or system (as for storage or for conversion in kind or in characteristics) (generator output, solar X-ray output)
Wood, Lumber, and Lumbering
BILLET: a chunky piece of wood (as for firewood)BOLT: a block of timber to be sawed or cut; also, a short round section of a logBRAND: a charred piece of wood or a firebrand, a piece of burning wood, or something (such as lightning) that resembles a firebrandBUTT: to trim or square off (something, such as a log) at the endBUTTED: to trim or square off (something, such as a log) at the endBUTTING: to trim or square off (something, such as a log) at the endCANT: a log with one or more squared sidesCHIP: to cut into chips (chip a tree stump)CHIPPED: to cut into chips (chip a tree stump)CHIPPING: to cut into chips (chip a tree stump)CLAVE: to split, especially along the grain, as woodCLEAVE: to split, especially along the grain, as woodCLEFT: to split, especially along the grain, as woodCORD: a unit of wood cut for fuel equal to a stack 4 x 4 x 8 feet or 128 cubic feetDEADWOOD: wood dead on the tree DEAL: pine or fir woodKNOT: the base of a woody branch enclosed in the stem from which it arises (also: its section in lumber)KNOTHOLE: a hole in a board or tree trunk where a knot or branch has come outLIMB: to cut off the limbs of (a felled tree)LOGGED: to cut (trees) for lumber [or fuel]; also, to clear (land) of trees in lumbering —often used with offLOGGING: to cut (trees) for lumber [or fuel]; also, to clear (land) of trees in lumbering —often used with offLOGROLL: to take part in logrolling (the rolling of logs in water by treading); also: a sport in which contestants treading logs try to dislodge one another
Words about Energy
LOAD: power output (as of a power plant) or power consumption (as by a device); also, a device to which power is delivered