LexiTopic: Animals

The LexiConnexxions analysis has identified 655 words that are used in 759 different ways related to Animals in the A-O portion of Spelling Bee lexicon, which comprises 74% of the entire lexicon. The list is given below, followed by the topical analysis, with definitions.
Words marked with an asterisk have been used in at least one Spelling Bee puzzle, then subsequently disallowed; they are retained here for historical interest. [Updated 2025-04-16]
Words Related to ANIMALS in the Spelling Bee lexicon: Word List
BALONEABDOMENADDLEADDLEDADDLINGADMIRALALIGHTALIGHTINGALITALLEYCATALLIGATORALPACAALPHAAMAZONAMEBAAMEBAEAMEBICAMOEBAAMOEBAEAMPHIBIANANACONDAANCHOVYANEMONEANGELANIMALANIMATEANKLEANTENNAANTENNAEANTHILLAPEMANAPEMENAPHIDAPIANAPIARIAN*APIARYAPOLLO*ARACHNIDARGONAUTARMADILLOARTHROPODATTRACTANTAVIANAVIARYAVOCETBAAEDBAAINGBABOONBACILLIBACKBALEENBANDBANDEDBANDINGBANTAMBARBBARKBARRINGBARROWBATEBATEDBATTYBAYEDBAYINGBEAGLEBEAKBEAKEDBEAMBEANBEATBEEFBEEHIVEBEEKEEPINGBEELINEBEETLEBELLBELLEDBELLINGBELLOWBELLOWEDBELLYBEVYBIDDY*BIGEYEBIGHEADBIGHEADEDBILLBILLEDBILLYBIOTABIRADIALBIRDBIRDBATHBITCH*BIVALVEBLACKCAPBLATBLAZEBLEATBLEWBLITZBLOATBLOODEDBLOODHOUNDBLOOMBLOOMEDBLOOMINGBLOWBLOWINGBLOWNBLUE
BLUEBOTTLEBLUEFINBOARBOBCATBOBOLINKBODYBONEBONGOBONITOBONOBOBOOBYBORZOIBOVIDBOWWOWBRAYBRAYINGBRONCBRONCOBROODBROODYBROWNBRUINBUCKBUFFBUFFALOBUGGYBUGLINGBUILDBULLBULLFROGBULLOCKBUMBLEBEEBUNNYBUNTINGBURBOTBURROBURROWBUTTOCKBUTTONCACKLECACKLEDCACKLINGCAIMANCALFCALICOCALLCALLEDCALLINGCALVECAMELCAMELBACKCANARYCANIDCANINECANNONCAPECAPONCARPCATBIRDCATTILYCATTLECATTYCAWINGCAYMANCELLCETACEANCHARCHARMCHATCHEEPCHEEPEDCHEETAHCHICKCHICKADEECHICKENCHIHUAHUACHIMPCHINCHILLACHIRPCHITINCHOWCHUBCHUMCHUNKCICADACICHLIDCIRRICIVETCLAMCLANGCLANGEDCLANGINGCLAWCLAWINGCLOACACLUCKCLUCKEDCLUTCHCOATCOATICOBRACOCCICOCKCOCKAPOOCOCKATOOCOCKLECOCKTAILCOCOONCOCOONEDCOCOONINGCOHO
COLLARCOLLIECOLTCOMBCOMMACOMPLETECONCHCONDORCONECOOEDCOOINGCOON*COOTCOOTIECORALCORGICORRIDORCOTTONMOUTHCOUCHCOURTCOVEYCOXACOYOTECRABCRAWCRAWDADCRAY*CROAKCROAKYCROCCROPCROUPCROWCRYINGCRYPTICCUCKOOCUTTLEDABBLINGDACE*DALMATIANDAPPLEDAPPLEDDIGITDINGODINODOBBIN*DODODOGFIGHTDOGGIEDOGGODOGGYDOGIEDOGTROTDOLPHINDORADODOVEDOWNDOWNYDRIFTDRILLDROPDROPPINGDRUMDUCKDUGONGDUMBEAGLEEAGLETEELYELANDELBOWELEPHANTENDEMICEPAULETEQUINEETHOLOGY*FACETFALLFALLSFANCILYFANGFANGEDFANTAILFARROWFAUNAFAUNAEFAUNALFAWNFEEDFEEDINGFELIDFELINEFELLFEMALEFILLYFILMFINCHFINNEDFLAGFLAGELLAFLANKFLAPFLAPPINGFLEAFLEDGEFLEDGEDFLEDGINGFLEDGLINGFLEECEFLEWFLIGHT
FLOATFLOCKFLOWNFLUFFFLUFFEDFLUFFILYFLUFFINGFLUFFSFLUFFYFLYINGFOALFOALSFOOTFORAGINGFORMFORMICFOWLFRILLFROGFROGGYFUGUFURRYGAGGLEGAITGALLGALLEDGALLINGGALLOP GANNETGAPEGATORGAZELLEGECKOGELTGIBBONGILLGILTGLUTTONGNARLGNATGOATGOBBLEGOBBLEDGOBBLINGGOBYGOONYGORILLAGRITGRITTINGGROUNDHOGGROWLGRUBGRUBBYGRUNTGUANOGULLGULLETGUPPYHACKHACKEDHACKLEHACKNEYHAGGARDHAIRHAIRYHAKEHALCYONHALIBUTHAMACHIHANDHARTHATCHHAUNCHHAWKHEATHEAVEHEEHAWHEEHAWEDHEELHIDEHINDHINNYHIPPOHIVEHOBBYHOCKHOCKHOLEHOLEDHOLINGHOLTHOMEHOMEDHOMINGHOMINIDHOMINOIDHOMOGAMYHONEYHONEYBEEHONEYDEWHONKHOODHOODEDHOODIEHOOFHOOFEDHOOTHOOTEDHOOTINGHORNHORNYHOUND
HOWLHOWLINGHUMANHUMPHUNTHUNTEDHYDRAHYENAIBEXIGUANAIMMIGRANTIMPALAIMPRINTINBORNINNATEIVORYJACKJACKALJADEJAKEJAVELINAJAYBIRDJELLYJENNYJOEYJOINTJUNCOJUVENILEKEELKELPIEKENNELKETTLEKIDDEDKIDDINGKINGKITEKITTENKITTYKIWIKNEEKNOTKOALAKRILLKUDULABIALABIALLADYBUGLAIDLAIRLAMBLAMELLA*LAMELLAE*LAMINALAMINAELAMINALLANDLANDEDLANDINGLARKLARVALARVALLAYINGLEGGEDLEGGYLEMMINGLEONINELICELICKLICKEDLICKINGLIFTLIMBLIMPETLINNETLIONLITTLELITTLENECKLIZARDLLAMALOACHLOBAR*LOBELOBEDLOBOLODGELOINLONGHORNLOONLOPELOPINGLOWEDLOWINGLUNGLUPINELYNXMAHIMAHIMAILMAKIMAKOMALAMUTEMALARIAMALARIALMALLARDMAMBAMAMMAMAMMALMAMMALIANMAMMALOGYMAMMARYMAMMOTHMANATEE
MANEMANGEMANGYMANNAMANTAMANTLEMARKMARMOTMARTINMATEMATEDMATINGMAXILLAMAXILLAMAYFLYMELANINMELONMEOWMEOWEDMEOWINGMEWEDMEWINGMICEMIDGEMIGRANTMIGRATINGMIMICMIMICKINGMIMICRYMINKMINNOWMITEMOBBEDMOBBINGMODELMOLEMOLLYMOLTMONADMONARCHMONITORMONKMONOGAMYMOOEDMOOINGMORAYMORPHMOTHMOTHYMOUNTMOUNTEDMOURNMOURNINGMOUTHMULEMULLETMULTIPLYMUTEMUTEDMUTINGMUTTMYNAMYNAHNAGGYNAIADNAILNAKEDNAUTILINEATNECKNEIGHNEIGHINGNENENEWTNIPPLENOTENUMBATNUPTIALNUTHATCHOCELOTOCTOPIOCTOPODOINKOINKINGOPAH*ORANGORANGUTANORCAORGANORIBI*ORPHANOUNCEOVARYOVINEOVULAROVULEOWLETOXENOXLIKE
Words Related to ANIMALS in the Spelling Bee lexicon: Topical Arrangement
Subject Headings
AmphibiansAnimal Behavior, Groups, etc. not birdsAnimal DiseaseAnimal HomesAnimal Morphology and Coloration not birdsAnimal Reproduction and Young general; not birds, not specific types of animalsAnimal Sounds not birds
Birds: BehaviorBirds: Bird TypesBirds: Domestic Birds Birds: Flight and FlockingBirds: Morphology and PlumageBirds: Reproduction and YoungBirds: SoundsBirds: Words about BirdsFishInsects, Arachnids, etc.Invertebrates not microorganisms
Mammals: AntelopesMammals: Bovine Mammals: CanineMammals: Caprine (goats)Mammals: Cervine (deer)Mammals: CetaceansMammals: ElephantsMammals: EquineMammals: FelineMammals: Leporine (hares)Mammals: Marsupials
Mammals: Mustelids Mammals: OtherMammals: OvineMammals: PorcineMammals: PrimatesMammals: RodentsMammals: SirenianMicroorganismsMollusks and CrustaceansReptilesWords about Animals
Amphibians
AMPHIBIAN: an amphibious organism, especially: any of a class (Amphibia) of cold-blooded vertebrates (such as frogs, toads, or salamanders) intermediate in many characters between fish and reptiles and having gilled aquatic larvae and air-breathing adultsBULLFROG: a heavy-bodied deep-voiced frog (Rana catesbeiana) of the eastern U.S. and southern CanadaFROG: any of various largely aquatic leaping anuran amphibians (such as ranids) that have slender bodies with smooth moist skin and strong long hind legs with webbed feetFROGGY: abounding in frogs: of, relating to, or resembling frogsNEWT: any of various small salamanders (family Salamandridae) that are usually semiaquatic as adults
Animal Behavior, Groups, Etc.
ALPHA: a socially dominant person or animalBEVY: a group of animals and especially quailBLITZ: an occurrence in which large numbers of fish gather to chase and feed on prey or baitBLOOM: a rapid and excessive growth of a plankton population (as of algae or dinoflagellates); also, to become densely populated with microorganisms and especially plankton —used of bodies of water; also, a large aggregation of free-swimming organisms: a swarm (a jellyfish bloom)BLOOMED: a rapid and excessive growth of a plankton population (as of algae or dinoflagellates); also, to become densely populated with microorganisms and especially plankton —used of bodies of water; also, a large aggregation of free-swimming organisms: a swarm (a jellyfish bloom)BLOOMING: a rapid and excessive growth of a plankton population (as of algae or dinoflagellates); also, to become densely populated with microorganisms and especially plankton —used of bodies of water; also, a large aggregation of free-swimming organisms: a swarm (a jellyfish bloom)CHARM: to control (an animal) typically by charms (such as the playing of music) (charm a snake)CORRIDOR: a land path used by migrating animalsDOGFIGHT: a fight between dogsDRIFT: synonym of drove (n): a group of animals driven or moving in a bodyETHOLOGY*: the scientific and objective study of Animal Behavior, Groups, etc. especially under natural conditionsFEED: to prey —used with on, upon, or offFEEDING: to prey —used with on, upon, or offFLOCK: a group of animals (such as birds or sheep) assembled or herded togetherFORAGING: of animals: wandering in search of forage or foodGAIT: a sequence of foot movements (such as a walk, trot, pace, or canter) by which a horse or a dog moves forward; also, to train (a horse or a dog) to use a particular gait or set of gaitsGUANO: broadly: excrement especially of seabirds or batsHUNT: to pursue for food; to traverse in search of prey (hunts the woods); also, the act, the practice, or an instance of huntingHUNTED: to pursue for food; to traverse in search of prey (hunts the woods); also, the act, the practice, or an instance of huntingIMPRINT: to fix indelibly or permanently (as on the memory); also, to subject to or induce by imprinting; also, to undergo imprintingINBORN: present from or as if from birth; hereditary, inheritedINNATE: existing in, belonging to, or determined by factors present in an individual from birth: native, inbornLICK: a natural salt deposit (such as a salt spring) that animals lick; also, an act or instance of licking; also, to draw the tongue over; to lap with or as if with the tongue; to take into the mouth with the tongue: to lapLICKED: an act or instance of licking; also, to draw the tongue over; to lap with or as if with the tongue; to take into the mouth with the tongue: to lapLICKING: an act or instance of licking; also, to draw the tongue over; to lap with or as if with the tongue; to take into the mouth with the tongue: to lapLOPE: an easy natural gait of a horse resembling a canter; also, an easy usually bounding gait capable of being sustained for a long time; also, to move or ride at a lopeLOPING: an easy natural gait of a horse resembling a canter; also, an easy usually bounding gait capable of being sustained for a long time; also, to move or ride at a lopeMIGRANT: an animal (such as a gray whale, monarch butterfly, leatherback sea turtle, or Canada goose) that moves usually long distances from one habitat or geographic region to another; also, [of organisms] to change position or location in an organism or substance (filarial worms migrate within the human body)MIGRATING: [of animals] to pass usually periodically from one region or climate to another for feeding or breeding
Animal Disease
BIGHEAD: any of several diseases of animals marked by swelling about the head BIGHEADED: any of several diseases of animals marked by swelling about the head BLOAT: digestive disturbance of ruminant animals and especially cattle marked by accumulation of gas in one or more stomach compartments; also, a condition of large dogs marked by distension and usually life-threatening rotation of the stomachGALL: a skin sore caused by chronic irritation (harness, etc.)GALLED: skin made sore by chronic irritationGALLING: making sore by chronic irritationGAPE: a disease of birds and especially young birds in which gapeworms invade and irritate the tracheaHEAVE: heaves plural in form but singular or plural in construction, veterinary medicine: chronic pulmonary emphysema of the horse resulting in difficult expiration, heaving of the flanks, and a persistent coughMALARIA: any of various diseases of birds and mammals caused by blood protozoansMALARIAL: any of various diseases of birds and mammals caused by blood protozoansMANGE: any of various persistent contagious skin diseases marked especially by eczematous inflammation and loss of hair, affecting domestic animals or sometimes humans, and caused by a minute parasitic miteMANGY: affected with or resulting from mange
Animal Homes
APIARY: a place where bees are kept, especially: a collection of hives or colonies of bees kept for their honeyAVIARY: a place for keeping birds confinedBEEHIVE: a container for housing honeybees; also, the usually aboveground nest of bees; also, a colony of beesBURROW: a hole or excavation in the ground made by an animal (such as a rabbit) for shelter and habitationCOUCH: the den of an animal (such as an otter)FORM: the resting place or nest of a hareHIVE: a container for housing honeybees; also, the usually aboveground nest of bees; also, a colony of beesHOLE: an animal’s burrow, or the act of creating a burrow or going into oneHOLED: an animal’s burrow, or the act of creating a burrow or going into oneHOLING: an animal’s burrow, or the act of creating a burrow or going into oneHOLT: M-W does not have a definition for holt as an otter’s den or couchHOME: of an animal: to return accurately to one's native area of place of birth or origin from a distance: to return home (to nest, spawn, etc.)HOMED: of an animal: to return accurately to one's native area of place of birth or origin from a distance: to return home (to nest, spawn, etc.)HOMING: of an animal: to return accurately to one's native area of place of birth or origin from a distance: to return home (to nest, spawn, etc.)KENNEL: a pack of dogsLAIR: the resting or living place of a wild animal: a denLODGE: a den or lair especially of gregarious animals (such as beavers)
Animal Morphology and Coloration
ABDOMEN: the posterior section of the body behind the thorax in an arthropodANKLE: the joint between the cannon bone and pastern (as in the horse)ANTENNA: one of a pair of slender, movable, segmented sensory organs on the head of insects, myriapods, and crustaceansANTENNAE: the pair of slender, movable, segmented sensory organs on the head of insects, myriapods, and crustaceansBACK: the part of a lower animal (such as a quadruped) corresponding to the human backBAND: a stripe (as on an animal) differentiable (as by color, texture, or structure) from the adjacent material or areaBELL: a bell-shaped organ or part (such as the dewlap of a moose), or the bell- or saucer-shaped, largely gelatinous structure that forms the main part of the body of most jellyfishBELLY: the undersurface of an animal's body; also: hide from this partBIRADIAL: having both bilateral and radial symmetryBLAZE: a usually white stripe down the center of the face of an animalBODY: the organized physical substance of an animal or plant either living or dead; also, the main part of a plant or animal body especially as distinguished from limbs and head: the trunkBONE: any of various hard animal substances or structures (such as baleen or ivory) akin to or resembling boneBUILD: the bodily conformation of a person or animal (a horse of stocky build)BUTTOCK: the rump, the upper rounded part of the hindquarters of a quadruped mammalCALICO: a blotched or spotted animal, especially: one that is predominantly white with red and black patches; from Calicut, IndiaCANNON: the part of the leg in which the cannon bone is foundCHITIN: a horny polysaccharide (C8H13NO5)n that forms part of the hard outer integument especially of insects, arachnids, and crustaceansCIRRI: plural of cirrus: a slender usually flexible animal appendage or projectionCLAW: a sharp usually slender and curved nail on the toe of an animal; also, to rake, seize, dig, or progress with or as if with claws; to scrape, scratch, dig, or pull with or as if with clawsCLAWING: to rake, seize, dig, or progress with or as if with claws; to scrape, scratch, dig, or pull with or as if with clawsCLOACA: the common chamber into which the intestinal and urogenital tracts discharge especially in monotreme mammals, birds, reptiles, amphibians, and elasmobranch fishesCOAT: the external growth on an animalCOLLAR: any of various animal structures or markings similar to a collarCOXA: the basal segment of a limb of various arthropods (such as an insect)CRAW: the crop of a bird or insect, or the stomach especially of a lower animalCROUP: the rump of a quadrupedCRYPTIC: serving to conceal (cryptic coloration in animals); also: exhibiting cryptic coloration (cryptic animals)DAPPLE: a dappled animalDAPPLED: a dappled animalDIGIT: any of the divisions in which the limbs of most vertebrates terminate…ELBOW: a joint in the anterior limb of a lower vertebrate corresponding to the human armFACET: the external corneal surface of an ommatidium, one of the elements corresponding to a small simple eye that make up the compound eye of an arthropodFANCILY: fancy: of an animal or plant: bred especially for bizarre or ornamental qualities that lack practical utilityFANG: a long sharp tooth: such as one by which an animal's prey is seized and held or tornFANGED: a long sharp tooth: such as one by which an animal's prey is seized and held or tornFELL: skin, hide, pelt; or a thin tough membrane covering a carcass directly under the hideFINNED: having a fin or finsFLAGELLA: plural of flagellum, any of various elongated filiform appendages of plants or animalsFLANK: the fleshy part of the side between the ribs and the hip; broadly: the side of a quadrupedFLOAT: a sac containing air or gas and buoying up the body of a plant or animalFRILL: a ruff of hair or feathers or a bony or cartilaginous projection about the neck of an animalFURRY: consisting of or resembling fur, or covered with furGAPE: the opening formed by the open mouth of an animal (such as a bird, fish, or snake)GULLET: esophagus, throatHAIR: a slender threadlike outgrowth of the epidermis of an animal, especially: one of the usually pigmented filaments that form the characteristic coat of a mammal; also, the hairy covering of an animal or a body part, especially: the coating of hairs on a human headHAIRY: covered with hair or hairlike material, or made of or resembling hairHAND: the forelimb segment (such as the terminal section of a bird's wing) of a vertebrate higher than the fishes that corresponds to the hand irrespective of its form or functional specialization; also, the hind foot of an apeHAUNCH: usually plural: hindquarters plural: the hind pair of legs of a quadruped; broadly: all the structures of a quadruped that lie posterior to the attachment of the hind legs to the trunkHEEL: the part of the hind limb of vertebrates that is similar in structure to the human heelHOCK: the tarsal joint or region in the hind limb of a digitigrade quadruped (such as the horse) corresponding to the human ankle but elevated and bending backwardHOOD: a color marking or crest on the head of an animal or an expansion of the head that suggests a hoodHOODED: having a color marking or crest on the head, or an expansion of the head that suggests a hoodHOOF: a curved covering of horn that protects the front of or encloses the ends of the digits of an ungulate mammal and that corresponds to a nail or claw; also, a hoofed foot especially of a horseHOOFED: having hoovesHORN: a permanent solid horn of keratin that is attached to the nasal bone of a rhinoceros; also, one of a pair of permanent bone protuberances from the skull of a giraffe or okapi that are covered with hairy skin; also, a natural projection or excrescence from an animal (e.g., an insect) resembling or suggestive of a hornHORNY: having hornsHUMP: a fleshy protuberance on the back of an animal (such as a camel, bison, or whale)IVORY: the hard creamy-white modified dentine that composes the tusks of a tusked mammal (such as an elephant, walrus, or narwhal); a tusk that yields ivoryJOINT: the point of contact between elements of an animal skeleton with the parts that surround and support itKNEE: the joint in the hind leg of a four-footed vertebrate that corresponds to the human knee; also, the carpal joint of the foreleg of a four-footed vertebrateLAMINA: one of the narrow thin parallel plates of soft vascular sensitive tissue that cover the flesh within the wall of a hoofLAMINAE: one of the narrow thin parallel plates of soft vascular sensitive tissue that cover the flesh within the wall of a hoofLAMINAL: arranged in, consisting of, or resembling laminae; a lamina is one of the narrow thin parallel plates of soft vascular sensitive tissue that cover the flesh within the wall of a hoofLEGGED: having a leg or legs especially of a specified kind or number —often used in combinationLEGGY: having many legsLIMB: One of the projecting paired appendages (such as wings) of an animal body used especially for movement and grasping but sometimes modified into sensory or sexual organsLITTLE: of a plant or animal: small in comparison with related forms —used in vernacular names (little egret)LOBAR*: of or relating to a lobeLOBE: a curved or rounded projection or division; specifically: a usually somewhat rounded projection or division of a bodily organ or partLOBED: having lobes (lobes of the lung, palmately lobed leaves)LOIN: the part of a human being or quadruped on each side of the spinal column between the hip bone and the false ribsLUNG: one of the usually paired compound saccular thoracic organs that constitute the basic respiratory organs of an air-breathing vertebrate; also, any of various respiratory organs of invertebratesMAIL: a hard enclosing covering of an animal (such as a tortoise)MAMMA: a mammary gland and its accessory partsMAMMARY: of, relating to, lying near, or affecting the mammaeMANE: long and heavy hair growing about the neck and head of some mammals (such as horses and lions)MARK: to furnish with natural marks (a bird’s wings marked with white; leaves marked with spots)MAXILLA: The jaw; especially an upper jaw especially of humans and other mammals in which the bony elements are closely fused; also, either of the two bones that lie with one on each side of the upper jaw lateral to the premaxilla and that in higher vertebrates bear most of the teeth: MELANIN: any of various black, brown, reddish-brown, reddish-yellow, or yellow pigments of living organisms that in animals are typically produced in melanocytes by the oxidation of tyrosine followed by polymerization and are found especially in skin, hair, feathers, and eyesMIMIC: to resemble by biological mimicry (a butterfly that mimics a leaf)MIMICKING: to resemble by biological mimicry (a butterfly that mimics a leaf)MIMICRY: superficial resemblance of one organism to another or to natural objects among which it lives that secures it a selective advantage (such as protection from predation)MODEL: an organism whose appearance a mimic imitatesMOLT: to shed hair, feathers, shell, horns, or an outer layer periodically; to cast off (an outer covering) periodically; specifically, to throw off (the old cuticle —used of arthropods; also, the act or process of moltingMORPH: a local population of a species that consists of interbreeding organisms and is distinguishable from other populations by morphology or behavior though capable of interbreeding with them; a phenotypic variant of a species; also, abbreviation of morphology, a branch of biology that deals with the form and structure of animals and plants; the form and structure of an organism or any of its partsMOUTH: the natural opening through which food passes into the body of an animal and which in vertebrates is typically bounded externally by the lips and internally by the pharynx and encloses the tongue, gums, and teethNAIL: a structure (such as a claw) that terminates a digit and corresponds to a nailNAKED: of an animal or one of its parts: lacking an external covering (as of hair, feathers, or shell) (naked amoebas)NECK: the part of an animal that connects the head with the bodyNIPPLE: the protuberance of a mammary gland upon which in the female the lactiferous ducts open and from which milk is drawn ORGAN: a differentiated structure (such as a heart, kidney, leaf, or stem) consisting of cells and tissues and performing some specific function in an organism; also, bodily parts performing a function or cooperating in an activity (the eyes and related structures that make up the visual organs)
Animal Reproduction and Young (general terms)
ATTRACTANT: a substance (such as a pheromone) that attracts specific animals (such as insects or individuals of the opposite sex)BLOODED: being entirely or largely purebredBROOD: (adj.) kept for breeding (a brood mare); also, to sit on or incubate (eggs); to produce by or as if by incubation: hatch; of a bird: to cover (young) with the wings; also, the young of an animal or a family of young, especially: the young (as of a bird or insect) hatched or cared for at one timeCOURT: of an animal: to perform actions in order to attract for mating (a male bird courting a female); to engage in activity leading to mating (a pair of robins courting in the trees)DROP: of an animal: to give birth to (drop a calf)DROPPING: of an animal: to give birth to (drop a calf)FEMALE: an individual of the sex that is typically capable of bearing young or producing eggs, or of, relating to, or being the sex that typically has the capacity to bear young or produce eggsHEAT: estrus: a regularly recurrent state of sexual receptivity during which the female of most mammals will accept the male and is capable of conceivingHOMOGAMY: the mating of like with likeJOEY: a baby animaKITTEN: an immature or young individual of various other small mammalsLAID: to bring forth and deposit (an egg)LARVA: the early form of an animal (such as a frog or sea urchin) that at birth or hatching is fundamentally unlike its parent and must metamorphose before assuming the adult charactersLARVAL: the early form of an animal (such as a frog or sea urchin) that at birth or hatching is fundamentally unlike its parent and must metamorphose before assuming the adult charactersLAYING: to bring forth and deposit (an egg)MATE: either member of a breeding pair of animals; also, to become matedMATED: either member of a breeding pair of animals; also, to become matedMATING: either member of a breeding pair of animals; also, to become matedMONOGAMY: zoology: the condition or practice of having a single mate during a period of timeMOUNT: to climb on top of for copulationMOUNTED: to climb on top of for copulationMULE: a usually sterile hybridMULTIPLY: to become greater in number; to spread; to breed, to propagate ORPHAN: a young animal that has lost its motherOVARY: one of the typically paired essential female reproductive organs that produce eggs and in vertebrates female sex hormonesOVULAR: of or relating to an ovule or ovum (a female gamete: macrogamete, called also egg cell)OVULE: a small egg, especially: one in an early stage of growth
Animal Sounds (not birds)
BAAED: to make the bleat of a sheepBAAING: to make the bleat of a sheepBARK: to make the characteristic short loud cry of a dog; to make a noise resembling a barkBAYED: to bark with prolonged tonesBAYING: to bark with prolonged tonesBELL: to make a resonant bellowing or baying sound; to bellow or roarBELLED: to make a resonant bellowing or baying sound; to bellow or roarBELLING: to make a resonant bellowing or baying sound; to bellow or roarBELLOW: to make the loud deep hollow sound characteristic of a bullBELLOWED: to make the loud deep hollow sound characteristic of a bullBLAT: M-W: variant of of “bleat” BLEAT: the cry of a sheep or goat; also, to make the natural cry of a sheep or goatBOWWOW: the bark of a dog, or a dogBRAY: to utter the characteristic loud harsh cry of a donkey; to utter a sound like a donkey'sBRAYING: to utter the characteristic loud harsh cry of a donkey; to utter a sound like a donkey'sBUGLING: to utter the characteristic rutting call of the bull elkCALL: the cry of a bird or other animal, or [for an animal or bird] to utter a characteristic note or cryCALLED: the cry of a bird or other animal, or [for an animal or bird] to utter a characteristic note or cryCALLING: the cry of a bird or other animal, or [for an animal or bird] to utter a characteristic note or cryCHIRP: the characteristic short sharp sound especially of a small bird or insect; also, to make a chirp or a sound resembling a chirpCROAK: a hoarse harsh cry or sound; also, to make a deep harsh soundCROAKY: a hoarse harsh cry or sound; also, to make a deep harsh soundCRYING: to utter a characteristic sound or call (heard the seagulls crying)DUMB: lacking the human power of speech (dumb animals)GNARL: to snarl or growlGROWL: a deep guttural inarticulate soundGRUNT: the deep short sound characteristic of a hogHEEHAW: M-W hyphenates hee-haw, the bray of a donkeyHEEHAWED: M-W hyphenates hee-haw, the bray of a donkeyHOWL: to emit a loud sustained doleful sound characteristic of members of the dog familyHOWLING: to emit a loud sustained doleful sound characteristic of members of the dog familyLOWED: of a cow: to mooLOWING: of a cow: to mooMEOW: the cry of a catMEOWED: the cry of a catMEOWING: the cry of a catMEWED: to utter a mew or similar sound; to utter by mewing: to meowMEWING: to utter a mew or similar sound; to utter by mewing: to meowMOOED: to make the throat noise of a cowMOOING: to make the throat noise of a cowNEIGH: to make the prolonged cry of a horseNEIGHING: to make the prolonged cry of a horse OINK: the natural noise of a hogOINKING: the natural noise of a hog
Birds: Behavior
BATE: of a falcon or hawk: to attempt to fly off something (such as a gauntlet) in fearBATED: of a falcon or hawk: to attempt to fly off something (such as a gauntlet) in fearDABBLING: of a bird: to reach with the bill to the bottom of shallow water in order to obtain food; adjective: dabbling ducks, those who dabble (as opposed to diving ducks)GRIT: of birds: to consume particles of sand or grit to aid in digestionGRITTING: of birds: to consume particles of sand or grit to aid in digestionHAWK: to hunt (someone or something) in flight like a hawk (e.g., birds hawking after insects)MANTLE: to spread the wings over, as a bird of prey does after a captureMOBBED: to crowd about and attack or annoy (mobbed by autograph hunters, a crow mobbed by songbirds); to crowd into or aroundMOBBING: to crowd about and attack or annoy (mobbed by autograph hunters, a crow mobbed by songbirds); to crowd into or aroundMUTE: of a bird: to evacuate the cloacaMUTED: of a bird: to evacuate the cloacaMUTING: of a bird: to evacuate the cloaca
Birds: Bird Types
AMAZON: M-W often capitalized: any of a genus (Amazona) of tropical American parrots typically having green plumage marked with other bright colors, named for the belief that they were native to Amazonian jungles,AVOCET: any of a genus (Recurvirostra) of rather large long-legged shorebirds with webbed feet and slender upward-curving billBANTAM: a small chicken, named for Bantam, former village in Java where the birds are believed to have originatedBIDDY*: a hen or a young chickenBIRD: a game birdBLACKCAP: any of several birds with black heads or crowns: such as a small gray European warbler (Sylvia atricapilla) with a black crown, or a chickadeeBOBOLINK: an American migratory songbird (Dolichonyx oryzivorus) with the breeding male chiefly black; the name is imitative of the bird’s tinkling songBOOBY: any of several tropical seabirds (genus Sula) of the gannet familyBUNTING: any of various stout-billed passerine birds (families Cardinalidae and Emberizidae) of which some are grouped with the cardinal and some with the New World sparrowsCANARY: a small finch (Serinus canarius synonym S. canaria) of the Canary Islands that is usually greenish to yellow and is kept as a cage bird and singerCAPON: a castrated male chickenCATBIRD: an American songbird (Dumetella carolinensis) that is dark gray in color with a black cap and reddish coverts under the tail and is related to the mockingbirdCHAT: any of several songbirds (as of the genera Cercomela, Granatellus, or Icteria)CHICK: a domestic chicken, especially: one newly hatchedCHICKADEE: any of several small North American oscine birds (genus Poecile of the family Paridae) that are related to the titmice…CHICKEN: any of various birds or their youngCOCK: a woodcock: a shorebird (Scolopax rusticola) of Europe and Asia that frequents moist woodlands, has large eyes and rounded wings, is of a variously mottled reddish-brown, black, and buff color with a barred chest, and is often hunted as game, or smaller related bird (Scolopax minor synonym Philohela minor) chiefly of eastern North America with a similar color pattern but having a solid orange buff chest; also, the adult male of any of several bird species, especially the adult male of the domestic chicken (gallus gallus): roosterCOCKATOO: any of various large noisy chiefly Australasian crested parrots (family Cacatuidae and especially genus Cacatua)COLT: M-W does not have this definition: a young Sandhill Crane CONDOR: a very large American vulture (Vultur gryphus) of the high Andes … the Andean condor or the California condor COOT: any of various slaty-black birds (genus Fulica) of the rail family, or any of several North American scoters (“sea coots”)CROW: any of various large usually entirely glossy black passerine birds (family Corvidae and especially genus Corvus)CUCKOO: a largely grayish-brown European bird (Cuculus canorus) that is a parasite given to laying its eggs in the nests of other birds which hatch them and rear the offspring; broadly any of a large family (Cuculidae of the order Cuculiformes) to which this bird belongs DODO: an extinct heavy flightless bird (Raphus cucullatus synonym Didus ineptus of the family Raphidae) of the island of Mauritius that was larger than a turkey and was related to the pigeon; or an extinct flightless bird (Raphus solitarius) of the island of Réunion similar to and closely related to the dodoDOVE: any of numerous pigeons, especially: a small wild pigeonDUCK: any of various swimming birds (family Anatidae, the duck family) in which the neck and legs are short, the feet typically webbed, the bill often broad and flat, and the sexes usually different from each other in plumage; also, a female duck, as opposed to drakeEAGLE: any of various large diurnal birds of prey (family Accipitridae) noted for their strength, size, keenness of vision, and powers of flightEAGLET: a young eagleFANTAIL: a domestic pigeon having a broad rounded tail often with 30 or 40 feathersFINCH: any of numerous passerine songbirds (families Fringillidae, Estrildidae, Emberizidae, and Cardinalidae) having a short stout usually conical bill adapted for crushing seedsFOWL: a bird of any kind; also, any of several wild gallinaceous birds (e.g., Guinea Fowl) GANNET: any of a genus (Morus of the family Sulidae, the gannet family) of large fish-eating seabirds that breed in colonies chiefly on offshore islandsGOONY: M-W: variant of gooney, the Black-footed Albatross, an albatross (Diomedea nigripes) of the Pacific that is chiefly blackish with dusky bill and black feet and legsGULL: any of numerous long-winged web-footed aquatic birds (subfamily Larinae of the family Laridae)HALCYON: a kingfisher, any of numerous nonpasserine birds (family Alcedinidae) that are usually crested and bright-colored with a short tail and a long stout sharp bill, or of or relating to the halcyon (kingfisher) or its nesting periodHAWK: any of numerous diurnal birds of prey belonging to a suborder (falcones of the order falconiformes) and including all the smaller members of this group; especially: accipiterHOBBY: a small Old World falcon (Falco subbuteo) that is dark blue above and white below with dark streaking on the breastHOODIE: the hooded merganser (Lophodytes cucullatus)JACK: any of several birds (such as a jackdaw)JAYBIRD: a predominantly fawn-colored Old World bird (Garrulus glandarius) of the crow family with a black-and-white crest and wings marked with black, white, and blue; also, any of various usually crested and largely blue chiefly New World birds that are related to the common Old World jay and have roving habits and harsh voicesJUNCO: any of a genus (Junco of the family Emberizidae) of small widely distributed North American finches usually having a pink bill, ashy gray head and back, and conspicuous white lateral tail feathersKITE: any of various usually small hawks (family Accipitridae) with long narrow wings and often a notched or forked tailKIWI: any of a small genus (Apteryx) of flightless New Zealand birds with rudimentary wings, stout legs, a long bill, and grayish brown hairlike plumageKNOT: either of two sandpipers (Calidris canutus and C. tenuirostris) that breed in the Arctic and winter in temperate or warm parts of the New and Old WorldLARK: any of a family (Alaudidae) of chiefly Old World ground-dwelling songbirds that are usually brownish in color, especially: skylarkLINNET: a common small brownish Old World finch (Acanthis cannabina) of which the male has red on the breast and crown during breeding seasonLOON: any of several large birds (genus Gavia of the family Gaviidae) of Holarctic regions that feed on fish by diving and have their legs placed far back under the body for optimal locomotion underwaterMALLARD: common and widely distributed wild duck (Anas platyrhynchos) of the northern hemisphere the males of which have a green head and white-ringed neck and which is the source of the domestic ducksMARTIN: a small Eurasian bird (Delichon urbica) of the swallow family with a forked tail, bluish-black head and back, and white rump and underparts; also, any of various birds (especially genus Progne) of the swallow family other than the Eurasian martin, probably from St. MartinMYNA: or myna, any of various Asian starlings (especially genera Acridotheres and Gracula), especially: a dark brown slightly crested bird (A. tristis) of southeastern Asia with a white tail tip and wing markings and bright yellow bill and feetMYNAH: variant of mynah, any of various Asian starlings (especially genera Acridotheres and Gracula), especially: a dark brown slightly crested bird (A. tristis) of southeastern Asia with a white tail tip and wing markings and bright yellow bill and feetNENE: an endangered goose (Branta sandvicensis synonym Nesochen sandvicensis) of the Hawaiian Islands that usually inhabits waterless uplands and feeds on berries and vegetationNUTHATCH: any of various small tree-climbing chiefly insectivorous birds (family Sittidae and especially genus Sitta) that have a compact body, a narrow bill, a short tail, and sometimes a black cap OWLET: a small or young owl, any of an order (Strigiformes) of chiefly nocturnal birds of prey with a large head and eyes, short hooked bill, strong talons, and soft fluffy often brown-mottled plumage
Birds: Flight and Flocking
ALIGHT: to descend from or as if from the air and come to restALIGHTING: to descend from or as if from the air and come to restALIT: alighted: to descend from or as if from the air and come to rest: land, settleBEAT: to strike the air: flap (as with a bird’s wings)BEVY: a group of animals and especially quailCOVEY: a mature bird or pair of birds with a brood of young, or a small flockFLAP: to beat or pulsate wings or something suggesting wings; to progress by flapping; to flutter ineffectivelyFLAPPING: to beat or pulsate wings or something suggesting wings; to progress by flapping; to flutter ineffectivelyFLEW: to move in or pass through the air with wings (birds, insects, etc.)FLIGHT: (noun) a group of similar beings or objects flying through the air together; a flock (a flight of geese)FLIGHT: (verb) to rise, settle, or fly in a flock (geese flighting on the marsh)FLOCK: a group of animals (such as birds or sheep) assembled or herded togetherFLOWN: to move in or pass through the air with wings (birds, insects, etc.)FLYING: to move in or pass through the air with wings (birds, insects, etc.)GAGGLE: a flock, especially: a flock of geese when not in flight KETTLE: a usually large group of raptors (such as hawks or vultures) circling high in the sky on an updraft of warm airKITE: of soaring birds: to hang in the wind with partially-closed wings, often assuming the shape of, and resembling, a kite (the toy, not the bird called a kite)LAND: to alight on a surfaceLANDED: to alight on a surfaceLANDING: to alight on a surfaceLIFT: the component of the total aerodynamic force acting on [a bird] that is perpendicular to the relative wind and that for [a bird] constitutes the upward force that opposes the pull of gravity; also, an updraft that can be used to increase altitude (as of a hawk)
Birds: Morphology and Plumage
BARRING: to mark with straight stripes, bands, or lines that are much longer than they are wide: to mark with bars (a feather barred with blue)BEAK: the bill of a bird, especially: a strong short broad billBEAKED: having a bill or beak, especially: a strong short broad billBEAN: a protuberance on the upper mandible of waterfowlBILL: the jaws of a bird together with their horny coveringBILLED: having a bill especially of a specified kindCAPE: the short feathers covering the shoulders of a fowlCOMB: a fleshy crest on the head of gallinaceous birds [not just domestic birds, as M-W says]CROP: a pouched enlargement of the esophagus of many birds that serves as a receptacle for food and for its preliminary maceration DOWN: a covering of soft fluffy feathersDOWNY: resembling a bird's down, or covered with down, or made of downEPAULET: specially adapted patches of feathers on a bird's shoulders that can be concealed or revealed for any of various displaysFLEDGE: of a young bird: to acquire the feathers necessary for flight or independent activity; also: to leave the nest after acquiring such feathersFLEDGED: of a young bird: to acquire the feathers necessary for flight or independent activity; also: to leave the nest after acquiring such feathersFLEDGING: of a young bird: to acquire the feathers necessary for flight or independent activity; also: to leave the nest after acquiring such feathersFLUFF: a covering of soft fluffy feathers; also: these feathers; or to make fluffy, as birds fluffing up their feathersFLUFFED: a covering of soft fluffy feathers; also: these feathers; or to make fluffy, as birds fluffing up their feathersFLUFFILY: covered with or resembling fluff, a covering of soft fluffy feathersFLUFFING: a covering of soft fluffy feathers; also: these feathers; or to make fluffy, as birds fluffing up their feathersFLUFFS: a covering of soft fluffy feathers; also: these feathers; or to make fluffy, as birds fluffing up their feathersFLUFFY: covered with or resembling fluff, a covering of soft fluffy feathersGAPE: the line along which the mandibles of a bird closeGILL: a wattle, a fleshy pendulous process usually about the head or neck (as of a bird)GULLET: esophagus, throatHACKLE: one of the long narrow feathers on the neck or saddle of a bird; also, the neck plumage of the domestic fowlHOCK: a joint of a fowl's leg that corresponds to the hock of a quadrupedHOOD: a color marking on the head of a bird that suggests a hoodHOODED: of birds: having a color marking on the head that suggests a hoodKEEL: an anatomical process forming a ridge (as on the sternum of a bird) (the carina)KNEE: the tarsal joint of a birdMANTLE: the upper back of a birdMARK: to furnish with natural marks (a bird’s wings marked with white; leaves marked with spots)MOLT: to shed hair, feathers, shell, horns, or an outer layer periodically; to cast off (an outer covering) periodically; specifically, to throw off (the old cuticle —used of arthropods; also, the act or process of molting
Birds: Reproduction and Young
ADDLE: to muddle eggs so that they will not hatchADDLED: to muddle eggs so that they will not hatchADDLING: to muddle eggs so that they will not hatchBIDDY*: a hen or a young chickenBROOD: the young of an animal or a family of young, especially: the young (as of a bird or insect) hatched or cared for at one time); also, to sit on or incubate (eggs); to produce by or as if by incubation: hatch; of a bird: to cover (young) with the wingsBROODY: being in a state of readiness to brood eggs that is characterized by cessation of laying and by marked changes in behavior and physiologyCHICK: the young of any birdCLUTCH: a nest of eggs or a brood of chicksCOCK: the male of birds other than the domestic chickenCOLT: M-W does not have this definition: a young Sandhill Crane EAGLET: a young eagleFLEDGE: of a young bird: to acquire the feathers necessary for flight or independent activity; also: to leave the nest after acquiring such feathersFLEDGED: of a young bird: to acquire the feathers necessary for flight or independent activity; also: to leave the nest after acquiring such feathersFLEDGING: of a young bird: to acquire the feathers necessary for flight or independent activity; also: to leave the nest after acquiring such feathersFLEDGLING: a young bird just fledged; also, a female bird feeding her fledglingsHACK: to rear (a young hawk) in a state of partial liberty especially prior to the acquisition of flight and hunting capabilitiesHACKED: to rear (a young hawk) in a state of partial liberty especially prior to the acquisition of flight and hunting capabilitiesHATCH: of birds: to incubate eggs: to brood; to sit on (eggs) so as to hatch by the warmth of the body; also, an act or instance of hatching; also, a brood of hatched youngJAKE: a sexually immature male wild turkey under two years old; probably from Jake, nickname for JacobJENNY: a young female turkey, or any female bird, especially a wren; from the name Jenny [Jenny Wren, Dickens, Our Mutual Friend]JUVENILE: a fledged bird not yet in adult plumageLAID: to bring forth and deposit (an egg)LAYING: to bring forth and deposit (an egg)NUPTIAL: characteristic of or occurring in the breeding season (nuptial flight, nuptial plumage) OWLET: a small or young owl, any of an order (Strigiformes) of chiefly nocturnal birds of prey with a large head and eyes, short hooked bill, strong talons, and soft fluffy often brown-mottled plumage
Birds: Sounds
CACKLE: to make the sharp broken noise or cry characteristic of a hen especially after layingCACKLED: to make the sharp broken noise or cry characteristic of a hen especially after layingCACKLING: to make the sharp broken noise or cry characteristic of a hen especially after layingCALL: the cry of a bird or other animal, or [for an animal or bird] to utter a characteristic note or cryCALLED: the cry of a bird or other animal, or [for an animal or bird] to utter a characteristic note or cryCALLING: the cry of a bird or other animal, or [for an animal or bird] to utter a characteristic note or cryCAWING: to utter the harsh raucous natural call of the crow or a similar cryCHEEP: imitative: to utter faint shrill sounds: to peepCHEEPED: imitative: to utter faint shrill sounds: to peepCHIRP: the characteristic short sharp sound especially of a small bird or insect; also, to make a chirp or a sound resembling a chirpCLANG: a harsh cry of a bird (such as a crane or goose); also, to utter the characteristic harsh cry of a birdCLANGED: a harsh cry of a bird (such as a crane or goose); also, to utter the characteristic harsh cry of a birdCLANGING: a harsh cry of a bird (such as a crane or goose); also, to utter the characteristic harsh cry of a birdCLUCK: the characteristic sound made by a hen especially in calling her chicksCLUCKED: the characteristic sound made by a hen especially in calling her chicksCOOED: to make the low soft cry of a dove or pigeon or a similar soundCOOING: to make the low soft cry of a dove or pigeon or a similar soundCROAK: a hoarse harsh cry or sound; also, to make a deep harsh soundCROAKY: a hoarse harsh cry or sound; also, to make a deep harsh soundCROW: to make the loud shrill sound characteristic of a cockCROW: to make the loud shrill sound characteristic of a cock, or the soundCRYING: to utter a characteristic sound or call (heard the seagulls crying)CUCKOO: the call of the cuckooGOBBLE: to make the natural guttural noise of a male turkeyGOBBLED: to make the natural guttural noise of a male turkeyGOBBLING: to make the natural guttural noise of a male turkeyHONK: the characteristic cry of a goose; also, to make such a sound; also: a similar soundHOOT: to make the natural throat noise of an owl or a similar cry; also, a sound of hooting, especially: the cry of an owlHOOTED: to make the natural throat noise of an owl or a similar cry; also, a sound of hooting, especially: the cry of an owlHOOTING: to make the natural throat noise of an owl or a similar cry; also, a sound of hooting, especially: the cry of an owlMOURN: to murmur mournfully —used especially of dovesMOURNING: to murmur mournfully —used especially of dovesNOTE: a call or sound, especially: the musical call of a bird
Birds: Words about Birds
AVIAN: of, relating to, or derived from birdsAVIARY: a place for keeping birds confinedBAND: the attachment of a small, individually numbered metal or plastic tag to the leg or wing of a wild birdBANDED: the attachment of a small, individually numbered metal or plastic tag to the leg or wing of a wild birdBANDING: the attachment of a small, individually numbered metal or plastic tag to the leg or wing of a wild birdBIRD: any of a class (Aves) of warm-blooded vertebrates distinguished by having the body more or less completely covered with feathers and the forelimbs modified as wingsBIRDBATH: a usually ornamental basin set up for birds to bathe inHAGGARD: of a hawk: not tamed; also, an adult hawk caught wildHAWK: to hunt birds by means of a trained hawk: to practice falconryHIDE: a blind, a place of concealment from which to watch birdsHOOD: in falconry: a covering for a hawk's head and eyes
Fish
ANCHOVY: any of a family (Engraulidae) of small fishes resembling herrings that includes several (such as Engraulis encrasicholus) that are important food fishes …ANGEL: the angelfish; any of several laterally compressed brightly colored bony fishes (family Pomacanthidae) of warm seasBIGEYE: any of several small widely distributed reddish to silvery bony fishes (genus Priacanthus of the family Priacanthidae) of tropical seasBLITZ: an occurrence in which large numbers of fish gather to chase and feed on prey or baitBLUE : bluefish, an active food and game marine fish (Pomatomus saltatrix) that is bluish above with silvery sides, or any of various dark or bluish fishes (such as the pollack)BLUEFIN: a very large tuna (Thunnus thynnus) that is an important food and game fish; called also bluefinBONITO: any of several swift-swimming scombroid fishes (genus Sarda) that are typically dark blue to bluish-green with dark stripes and a silvery belly, that are intermediate in size between the related mackerel and tuna, and that are valued as food and sport fishes; bluefin tunaBROWN: the brown troutBUFF: any of several suckers (genus Ictiobus) found mostly in the Mississippi River valley; called also buffalo fishBUFFALO: any of several suckers (genus Ictiobus) found mostly in the Mississippi River valley; called also buffalo fishBURBOT: a Holarctic freshwater bony fish (Lota lota) of the cod family having barbels on the nose and chinCARP: a large variable Asian soft-finned freshwater cyprinid fish (Cyprinus carpio) of sluggish waters that is often raised for food and has been widely introduced into U.S. waters; also: any of various related cyprinid fishes (such as the grass carp); also, a fish (such as the European sea bream) resembling a carpCHAR: any of a genus (Salvelinus) of small-scaled trouts with light-colored spotsCHUB: any of numerous freshwater cyprinid fishes (as of the genera Gila and Nocomis), or any of several marine or freshwater fishes (such as the tautog) that are not cyprinidsCHUM: synonym of chum salmon, a metallic bluish green salmon (Oncorhynchus keta) of the northern Pacific Ocean and Arctic Oceanthat may reach a length of about 3.5 feet (1 meter) CICHLID: any of a family (Cichlidae) of mostly tropical spiny-finned usually freshwater fishes including several kept in tropical aquariumsCOHO: a rather small Pacific salmon (Oncorhynchus kisutch) that has light-colored flesh and is native to both coasts of the North Pacific and is stocked in the Great LakesDACE*: a small freshwater European cyprinid fish (Leuciscus leuciscus), or any of various small North American freshwater cyprinid fishesDOLPHIN: synonym for dolphinfish, either of two colorful, iridescent, saltwater fish (Coryphaena equiselis and C. hippurus of the family Coryphaenidae) …DORADO: synonym for mahi-mahi: “the flesh of a dolphinfish (Coryphaena hippurus) used for food” also: the fishDRUM: any of various chiefly marine bony fishes (family Sciaenidae) that make a drumming or croaking noise using their air bladder and associated musclesEELY: like an eel, any of numerous voracious elongate snakelike bony fishes (order Anguilliformes) that have a smooth slimy skin, lack pelvic fins, and have the median fins confluent around the tailFUGU: any of various very poisonous puffer fishes (family Tetraodontidae) that contain tetrodotoxin and that are used as food in Japan after the toxin-containing parts are removedGILL: an organ (as of a fish) for obtaining oxygen from waterGOBY: any of numerous spiny-finned fishes (family Gobiidae) that usually have the pelvic fins united to form a ventral sucking diskGRUNT: [from the noise it makes when taken from the water]: any of a family (Haemulidae synonym Pomadasyidae) of chiefly tropical marine bony fishesGUPPY: a small bony fish (Poecilia reticulata of the family Poeciliidae) especially of Barbados, Trinidad, and Venezuela that is a live-bearer and is often kept as an aquarium fish, named for R. J. L. Guppy †1916 Trinidadian naturalistHAKE: any of several marine food fishes (as of the genera Merluccius and Urophycis) related to the Atlantic codHALIBUT: any of several marine flatfishes (especially Hippoglossus hippoglossus of the Atlantic and H. stenolepis of the Pacific) that are widely used for food and include some of the largest bony fishesHAMACHI: NOAD: The young of the Japanese amberjack or yellowtail, which is fished and bred in Japan as a food fish.HIND: any of various spotted groupers (especially genus Epinephelus)HOUND: a dogfishJACK: any of several fishes, especially: any of various carangidsKING: a chinook salmonLOACH: any of a family (Cobitidae) of small Old World freshwater fishes related to the carpsMAHIMAHI: M-W indicates variant of mahi-mahi (also mahi mahi), the dolphinfish (Coryphaena hippurus), or its flesh used for foodMAKO: mako shark, called also mako, either of two relatively slender mackerel sharks (Isurus paucus and I. oxyrinchus) that are dark blue above and white below with long pointed snouts and that are notable sport fishMANTA: the manta ray, a ray (Manta birostris) that averages 22 feet (6.7 meters) in width with a weight reaching 3000 pounds (1361 kilograms) [American Spanish, from Spanish; from its shape like a cloak]MINNOW: a small cyprinid, killifish, or topminnow; also, any of various small fish that are less than a designated size and are not game fishMOLLY: any of various small, often brightly colored tropical fish (genus Poecilia) that are live-bearers found in fresh, brackish, or salt water and include several that are highly valued as aquarium fishes; by shortening from New Latin Mollienisia, former genus name, from Comte François N. Mollien †1850 French statesmanMORAY: M-W: moray eel, “called also moray” any of numerous often brightly colored eels (family Muraenidae) that have sharp teeth capable of inflicting a severe bite, that occur in warm seas, and that include a chiefly Mediterranean eel (Muraena helena) sometimes used for food; called also morayMULLET: any of a family (Mugilidae) of chiefly marine bony fishes with an elongate rather stout body OPAH*: a large elliptical laterally compressed marine bony fish (Lampris guttatus of the family Lampridae) with brilliant colors
Insects, Arachnids, etc.
ADMIRAL: any of several brightly colored nymphalid butterfliesANTHILL: a mound of debris thrown up by ants or termites in digging their nestAPHID: any of numerous very small soft-bodied homopterous insects (superfamily Aphidoidea) that suck the juices of plantsAPIAN: of or relating to beesAPIARIAN*: of or relating to beekeeping or beesAPIARY: a place where bees are kept, especially: a collection of hives or colonies of bees kept for their honeyAPOLLO*: M-W does not mention, and NOAD does not capitalize apollo, A large butterfly which has creamy-white wings marked with black and red spots, found chiefly on the mountains of mainland Europe.ARACHNID: any of a class (Arachnida) of arthropods comprising chiefly terrestrial invertebrates, including the spiders, scorpions, mites, and ticks, and having a segmented body divided into two regions of which the anterior bears four pairs of legs but no antennaeARTHROPOD: any of a phylum (Arthropoda) of invertebrate animals (such as insects, arachnids, and crustaceans) that have a segmented body and jointed appendages, a usually chitinous exoskeleton molted at intervals, and a dorsal anterior brain connected to a ventral chain of gangliaBEEHIVE: a container for housing honeybees; also, the usually aboveground nest of bees; also, a colony of beesBEEKEEPING: raising and caring for beesBEELINE: from the belief that nectar-laden bees return to their hives in a direct lineBEETLE: any of an order (Coleoptera) of insects having four wings of which the outer pair are modified into stiff elytra that protect the inner pair when at restBLEW: of insects: to deposit eggs or larvae on or inBLOW: of insects: to deposit eggs or larvae on or inBLOWING: of insects: to deposit eggs or larvae on or inBLOWN: of insects: to deposit eggs or larvae on or inBLUE: any of numerous small chiefly blue butterflies (family Lycaenidae)BLUEBOTTLE: any of several blowflies (genus Calliphora) that have the abdomen or the whole body iridescent blue in color and that make a loud buzzing noise in flightBUGGY: infested with bugsBUMBLEBEE: any of numerous large robust hairy social bees (genus Bombus)CELL: a membranous area bounded by veins in the wing of an insect; also, one of the compartments of a honeycombCHIRP: the characteristic short sharp sound especially of a small bird or insect; also, to make a chirp or a sound resembling a chirpCHITIN: a horny polysaccharide (C8H13NO5)n that forms part of the hard outer integument especially of insects, arachnids, and crustaceansCICADA: any of a family (Cicadidae) of homopterous insects which have a stout body, wide blunt head, and large transparent wings and the males of which produce a loud buzzing noise usually by stridulationCOCOON: an envelope often largely of silk which an insect larva forms about itself and in which it passes the pupa stageCOCOONED: an envelope often largely of silk which an insect larva forms about itself and in which it passes the pupa stageCOCOONING: an envelope often largely of silk which an insect larva forms about itself and in which it passes the pupa stageCOMB: a honeycomb: a mass of hexagonal wax cells built by honeybees in their nest to contain their brood and stores of honeyCOMMA: any of several nymphalid butterflies (genus Polygonia) with a silvery comma-shaped mark on the underside of the hind wingsCOMPLETE: of insect metamorphosis: characterized by the occurrence of a pupal stage between the motile immature stages and the adultCOOTIE: a body louse or head louseCROP: an enlargement of the digestive tract of an animal other than a bird (such as an insect)FANG: one of the chelicerae of a spider at the tip of which a poison gland opensFANGED: one of the chelicerae of a spider at the tip of which a poison gland opensFLEA: any of an order (Siphonaptera) of small wingless bloodsucking insects that have a hard laterally compressed body and legs adapted to leaping and that feed on warm-blooded animalsFORMIC: M-W has only the open compounds formic acid (a colorless pungent fuming vesicant liquid acid CH2O2 found especially in ants and in many plants and used chiefly in dyeing and finishing textiles) and formic aldehyde (formaldehyde)GNAT: any of various small usually biting dipteran fliesGRUB: a soft thick wormlike larva of an insect (such as a beetle)GRUBBY: infested with fly maggotsHATCH: of insects: to emerge from an egg, chrysalis, or pupa; an act or instance of hatching; also, a brood of hatched youngHIVE: a container for housing honeybees; also, the usually aboveground nest of bees; also, a colony of beesHONEY: a sweet viscid material elaborated out of the nectar of flowers in the honey sac of various bees; also, a sweet fluid resembling honey that is collected or elaborated by various insectsHONEYBEE: a honey-producing bee (genus Apis of the family Apidae), especially: a European bee (A. mellifera) introduced worldwide and kept in hives for the honey it producesHONEYDEW: a saccharine deposit secreted on the leaves of plants usually by aphids or scale insects or sometimes by a fungusKNEE: the joint between the femur and tibia of an insectLABIA: plural of labium, a lower mouthpart of an insect that is formed by the second pair of maxillae united in the middle lineLABIAL: of, relating to, or situated near the lips or labia, a lower mouthpart of an insect that is formed by the second pair of maxillae united in the middle lineLADYBUG: any of numerous small nearly hemispherical often brightly colored often spotted beetles (family Coccinellidae) of temperate and tropical regions that usually feed both as larvae and adults on other insects (such as aphids); called also lady beetle, ladybird, ladybird beetleLARVA: the immature, wingless, and often wormlike feeding form that hatches from the egg of many insects, alters chiefly in size while passing through several molts, and is finally transformed into a pupa or chrysalis from which the adult emergesLARVAL: the immature, wingless, and often wormlike feeding form that hatches from the egg of many insects, alters chiefly in size while passing through several molts, and is finally transformed into a pupa or chrysalis from which the adult emergesLICE: plural of louse, any of various small wingless usually flattened insects (orders Anoplura and Mallophaga) parasitic on warm-blooded animals; or a small usually sluggish arthropod (such as a biting louse) that lives on other animals or on plants and sucks their blood or juices; or any of several small arthropods (such as a book louse) that are not parasitic. (Note that the plural of louse, meaning a contemptible person, is louses.)MANNA: a product excreted by a scale insect (Trabutina mannipara) feeding on the tamarisk that is similar to manna, the sweetish dried exudate of a Eurasian ash (especially Fraxinus ornus) that contains mannitol and has been used as a laxative and demulcentMAXILLA: one of the first or second pair of mouthparts posterior to the mandibles in many arthropods (such as insects or crustaceans)MAYFLY: any of an order (Ephemeroptera) of insects with an aquatic nymph and a short-lived, fragile adult lacking mouthparts and having membranous, heavily veined wings and two or three long, threadlike tailsMIDGE: a tiny dipteran fly (such as a chironomid)MITE: any of numerous small acarid arachnids that often infest animals, plants, and stored foods and include important disease vectorsMONARCH: the monarch butterflyMOTH: any of various usually nocturnal lepidopteran insects with antennae that are often feathery, with a stouter body, duller coloring, and proportionately smaller wings than the butterflies, and with larvae that are plant-eating caterpillarsMOTHY: related to moths, any of various usually nocturnal lepidopteran insects with antennae that are often feathery, with a stouter body, duller coloring, and proportionately smaller wings than the butterflies, and with larvae that are plant-eating caterpillarsNAIAD: an aquatic insect nymph (as of a mayfly, dragonfly, damselfly, or stone fly)
Invertebrates NOS
ANEMONE: usually “sea anemone”: any of numerous usually solitary anthozoan polyps (order Actiniaria) whose form, bright and varied colors, and cluster of tentacles superficially resemble a flowerCORAL: the calcareous or horny skeletal deposit produced by anthozoan or rarely hydrozoan polyps…; or a piece of coral and especially of red coralHYDRA: not capitalized: any of numerous small tubular freshwater hydrozoan polyps (Hydra and related genera) having at one end a mouth surrounded by tentaclesLABIA: plural of labium, a liplike part of various invertebratesLABIAL: of, relating to, or situated near the lips or labia, a liplike part of various invertebrates
Mammals: Antelopes
BONGO: an African antelope (Tragelaphus eurycerus) that is chestnut red with narrow white vertical stripes and is found in forests from Sierra Leone to KenyaELAND: either of two large African antelopes (Taurotragus oryx synonym Tragelaphus oryx and Taurotragus derbianus synonym Tragelaphus derbianus) bovine in form with short spirally twisted horns in both sexesGAZELLE: any of numerous small to medium graceful and swift African and Asian antelopes (Gazella and related genera)IMPALA: large brownish antelope (Aepyceros melampus) of southeastern Africa that in the male has slender curved horns with ridgesKIDDED: to bring forth young, used of a goat or an antelopeKIDDING: to bring forth young, used of a goat or an antelopeKUDU: a large grayish brown African antelope (Tragelaphus strepsiceros) with large annulated spirally twisted horns; also : a related antelope (T. imberbis)LAMB: the young of various animals (such as the smaller antelopes) other than sheep; also, to bring forth (give birth to) a lamb ORIBI*: any of several small antelopes (genus Ourebia) of southern and eastern Africa that are tawny yellow above and white below and have straight annulated horns about five inches long
Mammals: Bovine
BEEF: an ox, cow, or bull in a full-grown or nearly full-grown state; especially: a steer or cow fattened for foodBOVID: any of a family (Bovidae) of ruminants that have hollow unbranched permanently attached horns present in usually both sexes and that include antelopes, oxen, sheep, and goatsBUFF: any of several wild bovids: such as the water buffalo, the cape buffalo, or the bison, especially the North American bisonBUFFALO: any of several wild bovids: such as water buffalo, cape buffalo, or bison, especially: a large North American bison (Bison bison) that has a dense coat of dark brown fur with a shaggy mane on the head and lower neck, short hollow horns, and heavy forequarters with a large muscular hump over the shoulders and that formerly was abundant in North America but is now reduced to small populations of plains and prairies chiefly of the central U.S. and Canada : American bisonBULL: a male bovine. especially: an adult uncastrated male domestic bovine; or a usually adult male of various large animals (such as elephants, whales, or seals)BULLOCK: a young bull; a castrated bull: a steerCALF: the young of the domestic cow; also: that of a closely related mammal (such as a bison); or the young of various large animals (such as the elephant or whale)CALVE: to give birth to a calfCATTLE: domesticated quadrupeds held as property or raised for use; specifically: bovine animals on a farm or ranchDOGIE: chiefly Western US: a motherless calf in a range herdHORN: one of the permanent paired hollow sheaths of keratin usually present in both sexes of cattle and their relatives that function chiefly for defense and arise from a bony core anchored to the skullLONGHORN: any of the long-horned cattle of Spanish derivation formerly common in the southwestern U.S.; the Texas longhornNEAT: the common domestic bovine (Bos taurus) plural: neat or neats OXEN: plural of ox, a domestic bovine mammal (Bos taurus); broadly: a bovine mammal, especially an adult castrated male domestic ox (a team of oxen) OXLIKE: resembling, suggestive of, or having the characteristics of an ox
Mammals: Canine
BEAGLE: any of a breed of small short-legged smooth-coated often black, white, and tan houndsBITCH*: a female dogBLOODHOUND: any of a breed of large powerful hounds of European origin remarkable for acuteness of smellBORZOI: any of a breed of large dogs developed in Russia especially for pursuing wolves that have a long silky usually white coat with darker markingsCANID: any of a family (Canidae) of carnivorous animals that includes the wolves, jackals, foxes, coyote, and the domestic dogCANINE: of or resembling that of a dog; of or relating to dogs or to the family (Canidae) including the canidsCHIHUAHUA: M-W capitalizes Chihuahua: any of a breed of very small roundheaded dogs that occur in short-coated and long-coated varieties, from Chihuahua, Mexico. NOAD does not capitalize.CHOW: M-W: variant “often capitalized of chow chow, any of a breed of heavy-coated sturdy muscular dogs of Chinese … called also chowCOCKAPOO: a dog that is a cross between a cocker spaniel and a poodleCOLLIE: any of a breed of large dogs developed in Scotland that occur in rough-coated and smooth-coated varieties and have erect ears and a long muzzleCORGI: short for for Welsh corgiCOYOTE: a buff-gray to reddish-gray swift carnivorous mammal (Canis latrans) of North America that is closely related to but smaller than the wolfDALMATIAN: often capitalized: : any of a breed of medium-sized dogs having a white short-haired coat with many black or brown spots; from the supposed origin of the breed in DalmatiaDINGO: a wild dog (Canis dingo) of Australia having a tan or reddish coat that is often considered a subspecies (C. familiaris dingo) of the domestic dogDOGGIE: a usually small dogDOGGO: an affectionate term for a dog (Australian origin?)DOGGY: a usually small dogDOGTROT: a quick easy gait suggesting that of a dogFALL: long hair overhanging the face of dogs of some breedsFALLS: long hair overhanging the face of dogs of some breedsFLAG: the tail of some dogs (such as a setter or hound); also: the long hair fringing a dog's tailGAIT: a sequence of foot movements (such as a walk, trot, pace, or canter) by which a horse or a dog moves forward; also, to train (a horse or a dog) to use a particular gait or set of gaits; also, to lead (a show dog) before a judge to display carriage and movementHACKLE: erectile hairs along the neck and back especially of a dogHOUND: a dog, especially any of numerous hunting breeds including both scent hounds (such as the bloodhound and beagle) and sight hounds (such as the greyhound and Afghan hound)HYENA: any of several large strong nocturnal carnivorous Old World mammals (family Hyaenidae) that usually feed as scavengersJACKAL: any of several small omnivorous canids (such as Canis aureus) of Africa and Asia having large ears, long legs, and bushy tailsKELPIE: any of a breed of energetic working dogs developed in Australia from British sheepdogsKENNEL: a pack of dogsLOBO: the gray wolf, a large, broad-headed, wide-muzzled wolf (Canis lupus) that has a dense, heavy coat of usually light brown or brownish gray interspersed with black above and yellowish white below and that was formerly widely distributed throughout North America and Eurasia but is now greatly restricted to the more northerly parts of its rangeLUPINE: wolfishMALAMUTE: a sled dog of northern North AmericaMUTT: a mongrel dog : a cur
Mammals: Caprine
BILLY: a billy goatFAWN: a young goat; a young individual of various animals related to the goatGOAT: any of various hollow-horned ruminant mammals (especially of the genus Capra) related to the sheep but of lighter build and with backwardly arching horns, a short tail, and usually straight hair, especially: one (Capra hircus) long domesticated for its milk, wool, and fleshIBEX: any of several wild goats (genus Capra, especially C. ibex) living chiefly in high mountain areas of the Old World and having large recurved horns transversely ridged in frontKIDDED: to bring forth young, used of a goat or an antelopeKIDDING: to bring forth young, used of a goat or an antelope
Mammals: Cervine
BEAM: the main stem of a deer's antlerBUCK: a male animal, especially: a male deer or antelopeFAWN: a young deer, especially: one still unweaned or retaining a distinctive baby coatFLAG: the tail of a deerHART: chiefly British: the male of the red deer especially when over five years old: a stag (compare to hind)HIND: chiefly British: the female of the red deer (compare to hart)HORN: an antler, one of the paired deciduous solid bony processes that arise from the frontal bone on the head of an animal of the deer family
Mammals: Cetaceans
BALEEN: a horny keratinous substance found in two rows of transverse plates which hang down from the upper jaws of baleen whalesBLEW: of a cetacean: to eject moisture-laden air from the lungs through the blowholeBLOW: of a cetacean: to eject moisture-laden air from the lungs through the blowholeBLOWING: of a cetacean: to eject moisture-laden air from the lungs through the blowholeBLOWN: of a cetacean: to eject moisture-laden air from the lungs through the blowholeCETACEAN: any of an order (Cetacea) of aquatic mostly marine mammals that includes the whales, dolphins, porpoises, and related forms…DOLPHIN: any of various small marine toothed whales … OR any of several related chiefly freshwater toothed whales … river dolphinMELON: a rounded organ in the front of the head of some cetaceans and all toothed whales that is composed of lipids and waxy material and is thought to be utilized in echolocation ORCA: a relatively small toothed whale (Orcinus orca of the family Delphinidae) that is black above with white underparts and white oval-shaped patches behind the eyes: A killer whale
Mammals: Elephants
ELEPHANT: a thickset, usually extremely large, nearly hairless, herbivorous mammal (family Elephantidae, the elephant family)MAMMOTH: any of a genus (Mammuthus) of extinct Pleistocene mammals of the elephant family distinguished from recent elephants by highly ridged molars, usually large size, very long tusks that curve upward, and well-developed body hair
Mammals: Equine
BARB: any of a northern African breed of horses that are noted for speed and endurance; French barbe, from Italian barbero, from barbero of Barbary, from Barberia Barbary, coastal region in AfricaBRONC: short for bronco, an unbroken or imperfectly broken range horse of western North AmericaBRONCO: an unbroken or imperfectly broken range horse of western North AmericaBURRO: a donkey, especially: a small donkey used as a pack animalCHUNK: a strong thickset horse usually smaller than a draft horseCOCKTAIL: a horse with its tail dockedCOLT: a young male horse, donkey, etc., esp. uncastrated and under the age of four years; a foal, especially: a male foal; also, a young male horse that is usually not castrated and has not attained an arbitrarily designated age (such as four years)DOBBIN*: a farm horse, or a quiet plodding horseEQUINE: of, relating to, or resembling a horse or the horse familyFILLY: a young female horse usually of less than four yearsFOAL: a young animal of the horse family, especially: one under one year; also, to give birth to a foalFOALS: a young animal of the horse family, especially: one under one year; also, to give birth to a foalFROG: the triangular elastic horny pad in the middle of the sole of the foot of a horseGALLOP: a bounding gait of a quadruped, specifically: a fast natural usually 4-beat gait of the horseHACK: a horse let out for common hire; also, a horse used in all kinds of work; or a horse worn out in service: a jade; also, a light easy saddle horse, especially: a three-gaited saddle horseHACKNEY: a horse let out for common hire; also, a horse used in all kinds of work; or a horse worn out in service: a jade; also, a light easy saddle horse, especially: a three-gaited saddle horseHINNY: a hybrid between a stallion and a female donkeyJACK: a male donkeyJADE: a broken-down, vicious, or worthless horseJENNY: a female donkey; from the name JennyMULE: a hybrid between a horse and a donkey, especially: the offspring of a male donkey and a mare NAGGY: [noun] a little nag: a pony
Mammals: Feline
ALLEYCAT: M-W has the open compound alley cat, a stray catBOBCAT: a common North American lynx (Lynx rufus) reddish in base color with dark markingsCATTILY: like a cat, or slyly spiteful: maliciousCATTY: resembling a cat; of or relating to a catCHEETAH: a long-legged, swift-moving cat (Acinonyx jubatus) about the size of a small leopard with a yellowish to tan coat covered with numerous round to oval black spots and blunt claws that only partially retract and having a current range restricted to Africa and isolated parts of IranFELID: a cat, or related to catsFELINE: a cat, or related to catsKITTEN: a young cat; also, to give birth to kittens KITTY: a cat, especially a kittenLEONINE: of, relating to, suggestive of, or resembling a lionLION: a large heavily built social cat (Panthera leo) of open or rocky areas chiefly of sub-Saharan Africa though once widely distributed throughout Africa and southern Asia that has a tawny body with a tufted tail and a shaggy blackish or dark brown mane in the male; also, any of several large wildcats, especially the cougar (a large powerful tawny-brown cat (Puma concolor synonym Felis concolor) formerly widespread in the Americas but now reduced in number or extinct in many areas, called also catamount, mountain lion, panther, puma)LYNX: any of several wildcats with relatively long legs, a short stubby tail, mottled coat, and usually tufted ears that are thought to comprise a distinct genus (Lynx) of the cat family or to be part of a genus (Felis) that includes the domestic cat and cougar: such as a lynx (L. lynx) of northern Europe and Asia; the bobcat; a North American lynx (L. canadensis) distinguished from the bobcat by its larger size, longer tufted ears, and wholly black tail tip; called also Canadian lynx OCELOT: a medium-sized American wildcat (Leopardus pardalis synonym Felis pardalis) that ranges from Texas to northern Argentina and has a tawny-yellow or grayish coat dotted and striped with blackOUNCE: the snow leopard
Mammals: Leporine
BUNNY: informal: rabbit, especially: a young rabbitFORM: the resting place or nest of a hareJACK: a jackrabbit, any of several large hares (genus Lepus) of western North America having very long ears and long hind legs
Mammals: Marsupials
JOEY: a baby animal, especially: a baby kangarooKOALA: an Australian arboreal marsupial (Phascolarctos cinereus) that has a broad head, large hairy ears, dense gray fur, and sharp claws and feeds on eucalyptus leaves; called also koala bearNUMBAT: a small Australian marsupial (Myrmecobius fasciatus of the family Myrmecobiidae) that has a reddish-brown coat with white stripes on the back, a pointed snout, and a long slender tongue used to feed chiefly on termites; called also banded anteater
Mammals: Mustelids
GLUTTON: the wolverine, a carnivorous usually solitary mammal (Gulo gulo) of the weasel family of northern forests and associated tundra that is dark brown with a light brown band on each side of the body and is noted for its strengthMINK: either of two slender-bodied semiaquatic carnivorous mammals (Neogale vison of North America and Mustela lutreola of Eurasia) of the weasel family that have partially webbed feet, a rather short bushy tail, and a soft thick coat
Mammals: Other
ALPACA: a domesticate mammal (Vicugna pacos synonym Lama pacos) especially of Peru that is probably descended from the vicuñaBATTY: of, relating to, or resembling a batBOAR: the male of any of several mammals (such as a guinea pig or bear)BRUIN: a bear, any of a family (Ursidae of the order Carnivora). From Middle Dutch, the name of the bear in Reynard the Fox.CAMEL: either of two large ruminant mammals (genus Camelus) that have one or two large humps of stored fat on the back and are used as draft and saddle animals in desert regions especially of Africa and Asia CAMELBACK: the back of a camelCIVET: any of various Old World carnivorous viverrid mammals with long bodies, short legs, and a usually long tailCOATI: either of two tropical American mammals (Nasua nasua and N. narica) related to the raccoon but with a longer body and tail and a long flexible snoutCOON*: raccoon [disallowed due to extreme offensiveness]HIPPO: short for hippopotamus, any of a family (Hippopotamidae) of very large, four-toed, chiefly aquatic, herbivorous artiodactyl mammals…LLAMA: any of a genus (Lama) of wild or domesticated, long-necked, South American ruminant mammals related to the camels but smaller and without a hump, especially: a domesticated llama (L. glama) descended from the guanaco and used especially in the Andes as a pack animal and a source of woolMAMMAL: any of a class (Mammalia) of warm-blooded higher vertebrates (such as placentals, marsupials, or monotremes) that nourish their young with milk secreted by mammary glands, have the skin usually more or less covered with hair, and include humansMAMMALIAN: any of a class (Mammalia) of warm-blooded higher vertebrates (such as placentals, marsupials, or monotremes) that nourish their young with milk secreted by mammary glands, have the skin usually more or less covered with hair, and include humansMOLE: any of numerous burrowing insectivores (especially family Talpidae) with tiny eyes, concealed ears, and soft fur
Mammals: Ovine
DOWN: often capitalized: a sheep of any breed originating in the downs of southern EnglandFLEECE: the coat of wool covering a wool-bearing animal (such as a sheep)FLOCK: a group of animals (such as birds or sheep) assembled or herded togetherGELT: M-W does not have this definition: An adult, female sheep that is not in lamb when others are. Often she has been kept away from the ram because of problems at a previous lambing. Gelt ewes are fattened for sale to the meat trade at a time when lamb is in short supplyLAMB: a young sheep, especially: one that is less than one year old or without permanent teeth also, to bring forth (give birth to) a lamb OVINE: of, relating to, or resembling sheep
Mammals: Porcine
BARROW: a male hog castrated before sexual maturityBOAR: an uncastrated male swine; also, an Old World wild hog (Sus scrofa) from which most domestic swine have been derivedFARROW: of swine: to give birth to young; also, a litter of pigs or an act of farrowing; also, of a cow: not pregnantGILT: a young female swineJAVELINA: the peccary, any of several largely nocturnal gregarious American mammals resembling the related pigs…
Mammals: Primates
APEMAN: M-W hyphenates ape-manAPEMEN: M-W hyphenates ape-menBABOON: any of a genus (Papio) of large gregarious primates of Africa and southwestern Asia having a long square naked muzzleBONOBO: a rare anthropoid ape (Pan paniscus) that has a more slender build and longer limbs than the related common chimpanzee (P. troglodytes) and that inhabits a small geographic region in equatorial Africa south of the Congo RiverCHIMP: short for chimpanzee, an anthropoid ape (Pan troglodytes) of equatorial Africa that is smaller and more arboreal than the gorillaDRILL: a western African baboon (Mandrillus leucophaeus synonym Papio leucophaeus) having a black face and brown coat and closely related to the mandrillGIBBON: any of a genus (Hylobates of the family Hylobatidae) of agile brachiating tailless apes of southeastern Asia that are the smallest and most arboreal anthropoid apesGORILLA: a very large typically black-colored anthropoid ape (Gorilla gorilla) of equatorial Africa … from Greek Gorillai, plural, a tribe of hairy women mentioned in an account of a voyage around AfricaHOMINID: any of a family (Hominidae) of erect bipedal primate mammals that includes recent humans together with extinct ancestral and related forms and in some recent classifications the great apes (the orangutan, gorilla, chimpanzee, and bonobo)HOMINOID: any of a superfamily (Hominoidea) of primates including recent hominids, gibbons, and pongids together with extinct ancestral and related forms (as of the genera Proconsul and Dryopithecus)HUMAN: a bipedal primate mammal (Homo sapiens): a personMAKI: a lemur, any of various arboreal diurnal or nocturnal, chiefly arboreal primates (superfamily Lemuroidea) of Madagascar and the Comoros Islands that usually have a longish muzzle, large eyes, very soft woolly fur, and a long furry tail and that feed on fruit and plant parts (such as leaves, flowers, and seeds) and sometimes insects and small animalsMONK: a monkeyNAIL: a horny sheath protecting the upper end of each finger and toe of humans and most other primates ORANG: an orangutan, any of several largely herbivorous arboreal anthropoid apes (Pongo pygmaeus, P. abelii, and P. tapanuliensis) of Borneo and Sumatra that are about ²/₃ as large as the gorilla and have brown skin, long sparse reddish-brown hair, and very long armsORANGUTAN: any of several largely herbivorous arboreal anthropoid apes (Pongo pygmaeus, P. abelii, and P. tapanuliensis) of Borneo and Sumatra that are about ²/₃ as large as the gorilla and have brown skin, long sparse reddish-brown hair, and very long arms
Mammals: Rodents
CHINCHILLA: either of two small South American rodents (Chinchilla laniger and C. brevicaudata of the family Chinchillidae) of the high Andes that are the size of large squirrels, have very soft pearly-gray fur, and are extensively bred in captivity; also: the fur of a chinchillaGROUNDHOG: a woodchuck, a grizzled thickset marmot (Marmota monax) chiefly of Alaska, Canada, and the northeastern U.S.LEMMING: any of various small short-tailed furry-footed rodents (such as genera Lemmus and Dicrostonyx) of circumpolar distribution that are notable for population fluctuations and recurrent mass migrationsMARMOT: any of a genus (Marmota) of stout-bodied short-legged chiefly herbivorous burrowing rodents of the squirrel family that have coarse fur, a short bushy tail, and very small ears and that hibernate during the winterMICE: plural of mouse, any of numerous small rodents (as of the genus Mus) with pointed snout, rather small ears, elongated body, and slender tail
Mammals: Sirenian
DUGONG: an aquatic, herbivorous, usually brownish-gray mammal (Dugong dugon) that inhabits warm coastal waters chiefly of southern Asia, Australia, and eastern Africa and resembles the related manatee…MANATEE: any of a genus (Trichechus of the family Trichechidae) of large, herbivorous, aquatic mammals that inhabit warm coastal and inland waters of the southeastern U.S., West Indies, northern South America, and West Africa and have a rounded body, a small head with a squarish snout, paddle-shaped flippers usually with vestigial nails, and a flattened, rounded tail used for propulsion
Microorganisms
AMEBA: any of a large genus (Amoeba) of naked rhizopod protozoans…AMEBAE: any of a large genus (Amoeba) of naked rhizopod protozoans…AMEBIC: any of a large genus (Amoeba) of naked rhizopod protozoans…AMOEBA: any of a large genus (Amoeba) of naked rhizopod protozoans…AMOEBAE: any of a large genus (Amoeba) of naked rhizopod protozoans…BACILLI: any of a genus (Bacillus) of rod-shaped gram-positive usually aerobic bacteria; bacterium, especially: a disease-producing bacteriumCOCCI: plural of coccus, any spherical or roughly spherical bacteriumFILM: a thin skin or membranous covering: a pellicle: an outer membrane of some protozoans (such as euglenoids or paramecia)GULLET: an invagination of the protoplasm in various protozoans (such as a paramecium) that sometimes functions in the intake of foodMONAD: a flagellated protozoan (as of the genus Monas)
Mollusks and Crustaceans
ABALONE: any of a genus (Haliotis) of edible rock-clinging gastropod mollusks that have a flattened shell slightly spiral in form, lined with mother-of-pearl, and with a row of apertures along its outer edgeARGONAUT: a pelagic cephalopod (genus Argonauta) of which the female has a delicate papery shell (uncapitalized)BIVALVE: any of a class (Bivalvia synonym Pelecypoda) of typically marine mollusks (such as clams, oysters, or scallops) that have a 2-valved hinged shell, are usually filter feeders, and lack a distinct headCLAM: any of numerous edible marine bivalve mollusks living in sand or mud, or a freshwater musselCOCKLE: any of various chiefly marine bivalve mollusksCONCH: any of various large spiral-shelled marine gastropod mollusks; also: its shell used especially for cameosCONE: any of a family (Conidae) of tropical marine gastropod mollusks that inject their prey with a potent toxinCORAL: a bright reddish ovary (as of a lobster or scallop)CRAB: any of numerous chiefly marine broadly built decapod crustaceansCRAWDAD: crayfish, used chiefly west of the Appalachians: any of numerous freshwater decapod crustaceansCRAY*: crayfish (Australia and New Zealand): any of numerous freshwater decapod crustaceansCUTTLE: cuttlefish: any of various marine cephalopod mollusks (order Sepioidea, especially genus Sepia) having eight short arms and two usually longer tentacles and differing from the related squid in having a calcified internal shellDRILL: a marine snail (Urosalpinx cinerea) destructive to oysters by boring through their shells and feeding on the soft parts; also, any of several mollusks related to the drillFOOT: a ventral muscular surface or process of a molluskJELLY: a jellyfishKRILL: planktonic crustaceans and their larvae (order or suborder Euphausiacea and especially genus Euphausia) that constitute the principal food of baleen whalesLAMELLA*: one of the thin plates composing the gills of a bivalve molluskLAMELLAE*: plural of lamella, one of the thin plates composing the gills of a bivalve molluskLIMPET: a marine gastropod mollusk (especially families Acmaeidae and Patellidae) that has a low conical shell broadly open beneath, browses over rocks or timbers in the littoral area, and clings very tightly when disturbedLITTLENECK: a young quahog suitable to be eaten raw; called also littleneck clam; named for Littleneck Bay, Long Island, New YorkMANTLE: a fold or lobe or pair of lobes of the body wall of a mollusk or brachiopod that in shell-bearing forms lines the shell and bears shell-secreting glands; also, the soft external body wall that lines the test or shell of a tunicate or barnacleNAUTILI: plural of nautilus, any of a genus (Nautilus) of cephalopod mollusks of the South Pacific and Indian oceans with a spiral chambered shell that is pearly on the inside; called also chambered nautilusNECK: the siphon of a bivalve mollusk (such as a clam) OCTOPI: plural of octopus, any of a genus (Octopus) of cephalopod mollusks that have eight muscular arms equipped with two rows of suckers; broadly: any octopod excepting the paper nautilusOCTOPOD: any of an order (Octopoda) of cephalopod mollusks (such as an octopus or argonaut) that have eight arms bearing sessile suckers
Reptiles
ALLIGATOR: either of two large carnivorous, thick-skinned, long-bodied, aquatic, crocodilian reptiles (Alligator mississippiensis of the southeastern U.S. and A. sinensis of China) that have a broad head with a slightly tapered, long, rounded, U-shaped snout and a special pocket in the upper jaw for reception of the enlarged lower fourth toothANACONDA: a large semiaquatic constricting snake (Eunectes murinus) of the boa family of tropical South America that may reach a length of 30 feet (9.1 meters); broadly: any of the large constricting snakesARMADILLO: any of a family (Dasypodidae) of burrowing edentate mammals found from the southern U.S. to Argentina and having the body and head encased in an armor of small bony platesBUTTON: the terminal segment of a rattlesnake's rattleCAIMAN: any of several Central and South American crocodilians (genera Caiman, Melanosuchus, and Paleosuchus) similar to alligatorsCAYMAN: less common spelling of caiman, any of several Central and South American crocodilians (genera Caiman, Melanosuchus, and Paleosuchus) similar to alligatorsCOBRA: any of several venomous Asian and African elapid snakes (genera Naja and Ophiophagus) that when excited expand the skin of the neck into a hood by movement of the anterior ribsCOTTONMOUTH: a water moccasin, a venomous semiaquatic pit viper (Agkistrodon piscivorus) chiefly of the southeastern U.S. that is closely related to the copperhead; or a harmless American colubrid water snake (genus Nerodia) resembling the true water moccasinCROC: short for crocodileDINO: shortened form of dinosaurFANG: one of the long hollow or grooved and often erectile teeth of a venomous snakeFANGED: one of the long hollow or grooved and often erectile teeth of a venomous snakeGATOR: short for alligator, either of two large carnivorous, thick-skinned, long-bodied, aquatic, crocodilian reptiles (Alligator mississippiensis of the southeastern U.S. and A. sinensis of China) that have a broad head with a slightly tapered, long, rounded, U-shaped snout and a special pocket in the upper jaw for reception of the enlarged lower fourth toothGECKO: any of numerous small chiefly tropical and nocturnal insectivorous lizards (family Gekkonidae)IGUANA: any of various large chiefly herbivorous usually green or brownish tropical American lizards (family Iguanidae, the iguana family) that have a serrated dorsal crest and large dewlapLIZARD: any of a suborder (Lacertilia) of reptiles distinguished from the snakes by a fused inseparable lower jaw, a single temporal opening, two pairs of well differentiated functional limbs which may be lacking in burrowing forms, external ears, and eyes with movable lids; broadly: any relatively long-bodied reptile (such as a crocodile or dinosaur) with legs and tapering tailMAMBA: any of several chiefly arboreal venomous green or black elapid snakes (genus Dendroaspis) of sub-Saharan AfricaMONITOR: the monitor lizard, any of various tropical carnivorous lizards (genus Varanus of the family Varanidae) of Australia, Asia, and Africa
Words About Animals
ANIMAL: any of a kingdom (Animalia) of living things including many-celled organisms and often many of the single-celled onesANIMATE: of or relating to animal life as opposed to plant lifeBIOTA: the flora and fauna of a regionENDEMIC: an organism that is restricted or peculiar to a locality or region: an endemic organismFAUNA: animal life, especially: the animals characteristic of a region, period, or special environment; from Latin Fauna, sister of FaunusFAUNAE: plural of fauna: animal life, especially: the animals characteristic of a region, period, or special environment; from Latin Fauna, sister of FaunusFAUNAL: related to fauna: animal life, especially: the animals characteristic of a region, period, or special environment; from Latin Fauna, sister of FaunusIMMIGRANT: a plant or animal that becomes established in an area where it was previously unknownMAMMAL: any of a class (Mammalia) of warm-blooded higher vertebrates (such as placentals, marsupials, or monotremes) that nourish their young with milk secreted by mammary glands, have the skin usually more or less covered with hair, and include humansMAMMALIAN: any of a class (Mammalia) of warm-blooded higher vertebrates (such as placentals, marsupials, or monotremes) that nourish their young with milk secreted by mammary glands, have the skin usually more or less covered with hair, and include humansMAMMALOGY: a branch of zoology dealing with mammals
Except where noted, all content ©2022-2025 and in perpetuity by LexiConnexxions. All rights reserved. Dissemination, re-use, or duplication by any means is prohibited except by express permission of the publisher. This site is not affiliated with The New York Times. Contact LexiConnexxions at info // @ // lexiconnexxions.com.